BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbS20293 (563 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ439060-16|CAD27767.1| 278|Anopheles gambiae hypothetical prot... 28 0.18 AY752905-1|AAV30079.1| 100|Anopheles gambiae peroxidase 11 prot... 27 0.56 AY334004-1|AAR01129.1| 194|Anopheles gambiae integrin protein. 25 1.3 AY334003-1|AAR01128.1| 194|Anopheles gambiae integrin protein. 25 1.3 AY334002-1|AAR01127.1| 194|Anopheles gambiae integrin protein. 25 1.3 AY334001-1|AAR01126.1| 194|Anopheles gambiae integrin protein. 25 1.3 AF492464-1|AAM11657.1| 803|Anopheles gambiae beta nu integrin s... 25 1.3 AJ439060-7|CAD27758.1| 849|Anopheles gambiae putative V-ATPase ... 25 1.7 AY081778-1|AAL91655.1| 507|Anopheles gambiae cytochrome P450 pr... 24 3.0 AY187040-1|AAO39754.1| 211|Anopheles gambiae putative antennal ... 24 3.9 AF487537-1|AAL93298.1| 507|Anopheles gambiae cytochrome P450 CY... 24 3.9 AF444783-1|AAL37904.1| 1356|Anopheles gambiae Trex protein. 23 5.2 AJ535204-1|CAD59404.1| 1187|Anopheles gambiae SMC2 protein protein. 23 9.1 AJ439060-8|CAD27759.1| 808|Anopheles gambiae putative V-ATPase ... 23 9.1 >AJ439060-16|CAD27767.1| 278|Anopheles gambiae hypothetical protein protein. Length = 278 Score = 28.3 bits (60), Expect = 0.18 Identities = 25/90 (27%), Positives = 36/90 (40%), Gaps = 12/90 (13%) Frame = -1 Query: 314 FESSQCIQQTFXDTPASLCQLLAFVVSTYNLNFIVFANRHGF-----------YIEFLS* 168 F SS I+Q +P C LA V+ N + ++ + Y+E L Sbjct: 86 FRSSWYIKQIGNMSPLMFCSSLAMVLLLLQANVVPANGKYVYHDQDDGLLDERYLEVLEG 145 Query: 167 FLR-QGRGHQHSPYM*RSTEMPLPVFPS*G 81 Q GH HS +S +P+PVF G Sbjct: 146 LKEAQAAGHLHSSVSEKSKTVPVPVFQKVG 175 >AY752905-1|AAV30079.1| 100|Anopheles gambiae peroxidase 11 protein. Length = 100 Score = 26.6 bits (56), Expect = 0.56 Identities = 12/35 (34%), Positives = 20/35 (57%) Frame = -1 Query: 233 TYNLNFIVFANRHGFYIEFLS*FLRQGRGHQHSPY 129 T+ L ++FA R+ F + S +++GR H PY Sbjct: 27 TFGLTRLLFAGRNPFGSDLASLNIQRGRDHALRPY 61 >AY334004-1|AAR01129.1| 194|Anopheles gambiae integrin protein. Length = 194 Score = 25.4 bits (53), Expect = 1.3 Identities = 16/41 (39%), Positives = 18/41 (43%), Gaps = 1/41 (2%) Frame = -2 Query: 505 CLRGLHGCG-SFLGVFTLVFAKCSQSALCSAIEDCFAVFIH 386 C G C SF G F Q ALCS+ EDC +H Sbjct: 42 CNCGRCSCDESFFGPFCET-KDGEQPALCSSYEDCIRCAVH 81 >AY334003-1|AAR01128.1| 194|Anopheles gambiae integrin protein. Length = 194 Score = 25.4 bits (53), Expect = 1.3 Identities = 16/41 (39%), Positives = 18/41 (43%), Gaps = 1/41 (2%) Frame = -2 Query: 505 CLRGLHGCG-SFLGVFTLVFAKCSQSALCSAIEDCFAVFIH 386 C G C SF G F Q ALCS+ EDC +H Sbjct: 42 CNCGRCSCDESFFGPFCET-KDGEQPALCSSYEDCIRCAVH 81 >AY334002-1|AAR01127.1| 194|Anopheles gambiae integrin protein. Length = 194 Score = 25.4 bits (53), Expect = 1.3 Identities = 16/41 (39%), Positives = 18/41 (43%), Gaps = 1/41 (2%) Frame = -2 Query: 505 CLRGLHGCG-SFLGVFTLVFAKCSQSALCSAIEDCFAVFIH 386 C G C SF G F Q ALCS+ EDC +H Sbjct: 42 CNCGRCSCDESFFGPFCET-KDGEQPALCSSYEDCIRCAVH 81 >AY334001-1|AAR01126.1| 194|Anopheles gambiae integrin protein. Length = 194 Score = 25.4 bits (53), Expect = 1.3 Identities = 16/41 (39%), Positives = 18/41 (43%), Gaps = 1/41 (2%) Frame = -2 Query: 505 CLRGLHGCG-SFLGVFTLVFAKCSQSALCSAIEDCFAVFIH 386 C G C SF G F Q ALCS+ EDC +H Sbjct: 42 CNCGRCSCDESFFGPFCET-KDGEQPALCSSYEDCIRCAVH 81 >AF492464-1|AAM11657.1| 803|Anopheles gambiae beta nu integrin subunit AgBnu protein. Length = 803 Score = 25.4 bits (53), Expect = 1.3 Identities = 16/41 (39%), Positives = 18/41 (43%), Gaps = 1/41 (2%) Frame = -2 Query: 505 CLRGLHGCG-SFLGVFTLVFAKCSQSALCSAIEDCFAVFIH 386 C G C SF G F Q ALCS+ EDC +H Sbjct: 618 CNCGRCSCDESFFGPFCET-KDGEQPALCSSYEDCIRCAVH 657 >AJ439060-7|CAD27758.1| 849|Anopheles gambiae putative V-ATPase protein. Length = 849 Score = 25.0 bits (52), Expect = 1.7 Identities = 15/50 (30%), Positives = 25/50 (50%) Frame = -2 Query: 328 IGLFSLNPLNVYNKLFXIHLHHFANCWPL*CPRTT*TSSSLRIGMDFTLN 179 +GLFS+ VYN +F ++ F + W + +S++ D TLN Sbjct: 456 MGLFSMYTGFVYNDIFSKSMNIFGSAWSV-----NYNTSTVMTNKDLTLN 500 >AY081778-1|AAL91655.1| 507|Anopheles gambiae cytochrome P450 protein. Length = 507 Score = 24.2 bits (50), Expect = 3.0 Identities = 10/19 (52%), Positives = 12/19 (63%) Frame = -2 Query: 187 TLNFCLSSLDRGEDINTRL 131 T+NFCL L + DI RL Sbjct: 319 TMNFCLYELAKNPDIQGRL 337 >AY187040-1|AAO39754.1| 211|Anopheles gambiae putative antennal carrier protein A5 protein. Length = 211 Score = 23.8 bits (49), Expect = 3.9 Identities = 11/26 (42%), Positives = 15/26 (57%) Frame = +3 Query: 24 WCFCVAAKSDRMKFNKQVTSSRRKNR 101 + F V + R+ FN+ V SSR NR Sbjct: 144 YVFLVYKQPSRIVFNETVLSSRNPNR 169 >AF487537-1|AAL93298.1| 507|Anopheles gambiae cytochrome P450 CYP6P2 protein. Length = 507 Score = 23.8 bits (49), Expect = 3.9 Identities = 10/19 (52%), Positives = 12/19 (63%) Frame = -2 Query: 187 TLNFCLSSLDRGEDINTRL 131 T+NFCL L + DI RL Sbjct: 320 TMNFCLYELAKHPDIQERL 338 >AF444783-1|AAL37904.1| 1356|Anopheles gambiae Trex protein. Length = 1356 Score = 23.4 bits (48), Expect = 5.2 Identities = 7/18 (38%), Positives = 11/18 (61%) Frame = +1 Query: 331 CNSICRHSPFKVCDCQVE 384 C ++C F CDC++E Sbjct: 740 CFALCHCCDFYACDCKME 757 >AJ535204-1|CAD59404.1| 1187|Anopheles gambiae SMC2 protein protein. Length = 1187 Score = 22.6 bits (46), Expect = 9.1 Identities = 15/69 (21%), Positives = 36/69 (52%) Frame = +3 Query: 159 SKELRQKFNVKSMPIRKDDEVQVVRGHYKGQQLAK*CRCIXKSLLYTLRGFKEKRPMVQQ 338 SKEL+ K++ + ++++DE++ + K ++ K R K + G ++K P + + Sbjct: 884 SKELKAKYHQRDKLLKQNDELK-LEIKKKENEITK-VRNENKDGYDRISGMEQKYPWIPE 941 Query: 339 HMSAFTLQS 365 F +++ Sbjct: 942 DKEFFGVKN 950 >AJ439060-8|CAD27759.1| 808|Anopheles gambiae putative V-ATPase protein. Length = 808 Score = 22.6 bits (46), Expect = 9.1 Identities = 9/27 (33%), Positives = 16/27 (59%) Frame = -2 Query: 328 IGLFSLNPLNVYNKLFXIHLHHFANCW 248 +G+FS+ VYN +F ++ F + W Sbjct: 446 MGIFSMYTGFVYNDVFSKGMNIFGSAW 472 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 549,913 Number of Sequences: 2352 Number of extensions: 11658 Number of successful extensions: 27 Number of sequences better than 10.0: 14 Number of HSP's better than 10.0 without gapping: 27 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 27 length of database: 563,979 effective HSP length: 61 effective length of database: 420,507 effective search space used: 52983882 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -