BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbS20292 (444 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AF498306-5|AAM19330.1| 456|Apis mellifera dopamine receptor typ... 22 3.5 DQ000307-1|AAY21180.1| 423|Apis mellifera major royal jelly pro... 21 4.6 AF144379-1|AAD34586.1| 543|Apis mellifera glutamate transporter... 21 4.6 AY395072-1|AAQ96728.1| 593|Apis mellifera GABA neurotransmitter... 21 8.0 AY395071-1|AAQ96727.1| 646|Apis mellifera GABA neurotransmitter... 21 8.0 >AF498306-5|AAM19330.1| 456|Apis mellifera dopamine receptor type D2 protein. Length = 456 Score = 21.8 bits (44), Expect = 3.5 Identities = 15/45 (33%), Positives = 23/45 (51%), Gaps = 4/45 (8%) Frame = +3 Query: 150 FTESLTNLIFGSLLNY----FKIILDILEFVRALNIRQFTLKHNT 272 FTE L LIF S +++ F ++ + RA I+ +LK T Sbjct: 200 FTEHLGYLIFSSTISFYLPLFVMVFTYYKIYRAAVIQTKSLKLGT 244 >DQ000307-1|AAY21180.1| 423|Apis mellifera major royal jelly protein 9 protein. Length = 423 Score = 21.4 bits (43), Expect = 4.6 Identities = 8/13 (61%), Positives = 10/13 (76%) Frame = -2 Query: 296 QDSVCPSACVVFE 258 + SVCPS VVF+ Sbjct: 146 ETSVCPSQIVVFD 158 >AF144379-1|AAD34586.1| 543|Apis mellifera glutamate transporter Am-EAAT protein. Length = 543 Score = 21.4 bits (43), Expect = 4.6 Identities = 7/20 (35%), Positives = 15/20 (75%) Frame = -1 Query: 90 DLFVLILCILMLIAGVILMY 31 D F+++ I+M + G+I+M+ Sbjct: 266 DFFMILNEIIMKLVGIIIMW 285 >AY395072-1|AAQ96728.1| 593|Apis mellifera GABA neurotransmitter transporter-1B protein. Length = 593 Score = 20.6 bits (41), Expect = 8.0 Identities = 7/25 (28%), Positives = 15/25 (60%) Frame = -1 Query: 93 QDLFVLILCILMLIAGVILMYGHGM 19 ++LF+ I+C + + G+ + GM Sbjct: 415 KELFIAIVCFVSYLIGLFCITEGGM 439 >AY395071-1|AAQ96727.1| 646|Apis mellifera GABA neurotransmitter transporter-1B protein. Length = 646 Score = 20.6 bits (41), Expect = 8.0 Identities = 7/25 (28%), Positives = 15/25 (60%) Frame = -1 Query: 93 QDLFVLILCILMLIAGVILMYGHGM 19 ++LF+ I+C + + G+ + GM Sbjct: 468 KELFIAIVCFVSYLIGLFCITEGGM 492 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 103,226 Number of Sequences: 438 Number of extensions: 1824 Number of successful extensions: 6 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 146,343 effective HSP length: 53 effective length of database: 123,129 effective search space used: 11574126 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.2 bits)
- SilkBase 1999-2023 -