BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbS20290 (548 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY753541-1|AAV28544.1| 3398|Anopheles gambiae SGS4 protein. 24 2.9 AB090814-2|BAC57904.1| 1049|Anopheles gambiae reverse transcript... 23 8.8 >AY753541-1|AAV28544.1| 3398|Anopheles gambiae SGS4 protein. Length = 3398 Score = 24.2 bits (50), Expect = 2.9 Identities = 12/43 (27%), Positives = 22/43 (51%) Frame = +2 Query: 143 KYDDYSQET*CFNENIKMLLTKDYLKQISSE*SLLFVLNKIND 271 K ++ T C+ +N+ ++LKQI+ E LF + +D Sbjct: 622 KLVNFKVNTTCYEQNVSFEYEGNWLKQINQEDRPLFKFDYKDD 664 >AB090814-2|BAC57904.1| 1049|Anopheles gambiae reverse transcriptase protein. Length = 1049 Score = 22.6 bits (46), Expect = 8.8 Identities = 9/26 (34%), Positives = 14/26 (53%) Frame = -2 Query: 337 LTGMITKEFLFIFNNFCVKIVNVIYF 260 +TG I + F FC+ VN ++F Sbjct: 57 VTGTIQRVVSNTFEGFCIAEVNGVFF 82 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 488,490 Number of Sequences: 2352 Number of extensions: 9542 Number of successful extensions: 17 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 17 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 17 length of database: 563,979 effective HSP length: 61 effective length of database: 420,507 effective search space used: 50881347 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -