BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbS20283 (468 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 03_01_0093 - 745434-746057,746492-747112,747222-747791,747870-74... 31 0.35 02_05_0916 - 32706039-32706332,32707483-32708103,32708450-327090... 31 0.35 04_04_1323 + 32644956-32645096,32645488-32646126,32646701-326469... 28 3.3 02_05_0785 - 31730300-31730701,31730785-31730856,31730940-317328... 27 5.7 12_01_0402 - 3179365-3180343,3180907-3182530,3183357-3183768 27 7.5 11_01_0256 + 1969292-1969563,1970004-1970270,1970413-1970989 27 7.5 >03_01_0093 - 745434-746057,746492-747112,747222-747791,747870-747948, 748258-748331,748385-748387 Length = 656 Score = 31.5 bits (68), Expect = 0.35 Identities = 19/76 (25%), Positives = 35/76 (46%) Frame = +1 Query: 25 FAKTPYKELINVTVGKPLGQLLISNLLHLPCIEKVFPDSEPVITDLPINLLKNAPKNISV 204 F T KE +GK + + +I+ + ++ I L + + N P ++ Sbjct: 149 FVLTKMKETAESYLGKSVSKAVITVPAYFNDAQRQATKDAGRIAGLDVQRIINEPTAAAL 208 Query: 205 IYGSNDKEGLFFVSEV 252 YG+N+KEGL V ++ Sbjct: 209 SYGTNNKEGLIAVFDL 224 >02_05_0916 - 32706039-32706332,32707483-32708103,32708450-32709070, 32709183-32709752,32709840-32709918,32710002-32710075, 32711336-32711398 Length = 773 Score = 31.5 bits (68), Expect = 0.35 Identities = 19/76 (25%), Positives = 35/76 (46%) Frame = +1 Query: 25 FAKTPYKELINVTVGKPLGQLLISNLLHLPCIEKVFPDSEPVITDLPINLLKNAPKNISV 204 F T KE +GK + + +I+ + ++ I L + + N P ++ Sbjct: 169 FVLTKMKETAESYLGKTVSKAVITVPAYFNDAQRQATKDAGRIAGLDVQRIINEPTAAAL 228 Query: 205 IYGSNDKEGLFFVSEV 252 YG+N+KEGL V ++ Sbjct: 229 SYGTNNKEGLIAVFDL 244 >04_04_1323 + 32644956-32645096,32645488-32646126,32646701-32646907, 32647020-32647100,32647686-32648566,32648641-32648932, 32649657-32650673,32651334-32651605,32651992-32652493 Length = 1343 Score = 28.3 bits (60), Expect = 3.3 Identities = 11/27 (40%), Positives = 18/27 (66%) Frame = +3 Query: 63 RWETPWSTFNFEFITFTLHRESLPRFG 143 R+ TP++T +F+ IT LH+ R+G Sbjct: 1158 RYATPFTTASFDVITDQLHKAGFSRWG 1184 >02_05_0785 - 31730300-31730701,31730785-31730856,31730940-31732864, 31733000-31733150,31733944-31734009,31734247-31734645 Length = 1004 Score = 27.5 bits (58), Expect = 5.7 Identities = 11/19 (57%), Positives = 15/19 (78%) Frame = -3 Query: 331 SVSRSDENLKSDPVIFNLL 275 S+SR E LK DPV+F++L Sbjct: 671 SLSRMKEKLKDDPVLFDIL 689 >12_01_0402 - 3179365-3180343,3180907-3182530,3183357-3183768 Length = 1004 Score = 27.1 bits (57), Expect = 7.5 Identities = 10/30 (33%), Positives = 21/30 (70%) Frame = +1 Query: 7 QELYDIFAKTPYKELINVTVGKPLGQLLIS 96 +E+++IF K+ + +++ + KPLG L+S Sbjct: 645 EEVHEIFTKSFFWDVLQQQLSKPLGSELVS 674 >11_01_0256 + 1969292-1969563,1970004-1970270,1970413-1970989 Length = 371 Score = 27.1 bits (57), Expect = 7.5 Identities = 15/41 (36%), Positives = 22/41 (53%) Frame = +3 Query: 285 KITGSDFKFSSDLETDEVTSKVKEFYFGENTISWETRMILS 407 K TGS F FS+ +E D T + YF E + ++ R L+ Sbjct: 147 KRTGSPFSFSNGVEIDHETGVI---YFTETSTRFQRREFLN 184 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,071,498 Number of Sequences: 37544 Number of extensions: 204289 Number of successful extensions: 476 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 461 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 476 length of database: 14,793,348 effective HSP length: 76 effective length of database: 11,940,004 effective search space used: 943260316 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -