Bombyx BLAST Result against mosquito

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fbS20272
         (436 letters)

Database: mosquito 
           2352 sequences; 563,979 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AY753541-1|AAV28544.1| 3398|Anopheles gambiae SGS4 protein.            23   4.7  
AJ697726-1|CAG26919.1|  198|Anopheles gambiae putative odorant-b...    22   8.2  
AJ271193-1|CAB66001.1| 1623|Anopheles gambiae laminin gamma 1 pr...    22   8.2  

>AY753541-1|AAV28544.1| 3398|Anopheles gambiae SGS4 protein.
          Length = 3398

 Score = 23.0 bits (47), Expect = 4.7
 Identities = 8/12 (66%), Positives = 10/12 (83%)
 Frame = -1

Query: 175  STGATNGVNRPP 140
            STG++N  NRPP
Sbjct: 1627 STGSSNSCNRPP 1638


>AJ697726-1|CAG26919.1|  198|Anopheles gambiae putative
           odorant-binding protein OBPjj16 protein.
          Length = 198

 Score = 22.2 bits (45), Expect = 8.2
 Identities = 10/32 (31%), Positives = 16/32 (50%)
 Frame = -3

Query: 347 ILERCRETGDV*HHLMAWGLPWQQQSTVTQCA 252
           I+E+CR        + A G+P  +   + QCA
Sbjct: 48  IMEKCRAENPKPGQMPAPGVPRTEGCCIVQCA 79


>AJ271193-1|CAB66001.1| 1623|Anopheles gambiae laminin gamma 1
           precursor protein.
          Length = 1623

 Score = 22.2 bits (45), Expect = 8.2
 Identities = 8/12 (66%), Positives = 9/12 (75%)
 Frame = -3

Query: 362 NRXGPILERCRE 327
           NR GP  ERC+E
Sbjct: 373 NRDGPNCERCKE 384


  Database: mosquito
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 563,979
  Number of sequences in database:  2352
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 401,113
Number of Sequences: 2352
Number of extensions: 6869
Number of successful extensions: 8
Number of sequences better than 10.0: 3
Number of HSP's better than 10.0 without gapping: 8
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 8
length of database: 563,979
effective HSP length: 59
effective length of database: 425,211
effective search space used: 36142935
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)