BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbS20270 (507 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 02_03_0300 + 17454622-17455402,17455535-17456977,17457015-174573... 27 6.5 >02_03_0300 + 17454622-17455402,17455535-17456977,17457015-17457317, 17458429-17458519,17458623-17459757,17459998-17460077, 17460449-17460533,17460614-17460705,17461079-17461147, 17461227-17461263,17461351-17461433,17461695-17461840, 17461868-17462138,17462245-17462281,17462428-17462721 Length = 1648 Score = 27.5 bits (58), Expect = 6.5 Identities = 17/41 (41%), Positives = 21/41 (51%), Gaps = 4/41 (9%) Frame = -2 Query: 281 QNAYTLFTYQTNSYRVQWECNLKN----RTSWSSLNKHTSS 171 Q AYT T Q NS R Q EC+ + R + KH+SS Sbjct: 1136 QEAYTTRTIQINSERSQPECSQQQDNDIRVQAKTCEKHSSS 1176 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,000,181 Number of Sequences: 37544 Number of extensions: 249061 Number of successful extensions: 393 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 390 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 393 length of database: 14,793,348 effective HSP length: 77 effective length of database: 11,902,460 effective search space used: 1083123860 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -