BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbS20265 (490 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF022967-10|AAB69875.3| 381|Caenorhabditis elegans Hypothetical... 28 4.2 Z77663-4|CAB01213.1| 605|Caenorhabditis elegans Hypothetical pr... 27 5.5 >AF022967-10|AAB69875.3| 381|Caenorhabditis elegans Hypothetical protein C13A2.3 protein. Length = 381 Score = 27.9 bits (59), Expect = 4.2 Identities = 13/34 (38%), Positives = 20/34 (58%) Frame = -3 Query: 488 LFSHKVMNFPTDEVAVLFLTIAVCKSLVRGIKSG 387 LFS+K +NF T VA+ + I + K+ + I G Sbjct: 8 LFSNKALNFITFSVAIALIFIIITKTTQKSILLG 41 >Z77663-4|CAB01213.1| 605|Caenorhabditis elegans Hypothetical protein F53F4.4 protein. Length = 605 Score = 27.5 bits (58), Expect = 5.5 Identities = 12/46 (26%), Positives = 25/46 (54%) Frame = +1 Query: 154 VRQSLEYENQGKGSIIQNVVNNLIIDGSRNTMEYATSCGSATDSTL 291 V Q ++ + G G ++ + + +GSR+ ++ + G+ TD TL Sbjct: 422 VEQEIDEGSDGSGESLEGSGSGDVPEGSRDKKKWENTPGNLTDETL 467 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.317 0.130 0.371 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,315,100 Number of Sequences: 27780 Number of extensions: 198184 Number of successful extensions: 555 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 533 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 555 length of database: 12,740,198 effective HSP length: 76 effective length of database: 10,628,918 effective search space used: 914086948 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -