BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbS20252 (538 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 08_01_0410 + 3661304-3661383,3661494-3661673,3661757-3661870,366... 31 0.44 04_04_0190 - 23442824-23442846,23442891-23442949,23443613-234437... 31 0.77 06_01_0605 + 4373697-4373872,4374840-4374876,4375296-4375399,437... 29 1.8 06_03_0095 - 16575938-16576585,16577028-16577219,16577294-165773... 29 2.3 12_01_0378 - 2946916-2947590 28 4.1 04_04_1212 - 31786063-31786195,31786275-31786398,31786486-317865... 27 7.2 08_02_0647 - 19687142-19687145,19687244-19689352,19689764-19690617 27 9.5 03_02_0081 - 5506194-5506197,5506310-5507170,5507299-5507456,550... 27 9.5 03_01_0300 + 2350232-2352274,2352349-2352669,2352752-2352838,235... 27 9.5 01_06_1485 + 37703696-37703815,37703970-37704044,37704598-377046... 27 9.5 01_05_0487 + 22641133-22642182,22642276-22642863,22642961-226430... 27 9.5 >08_01_0410 + 3661304-3661383,3661494-3661673,3661757-3661870, 3661975-3662133,3662193-3662243,3662838-3663018, 3663102-3663228,3663322-3663431,3663529-3663667, 3663767-3663876,3664002-3664071,3664247-3664320, 3664458-3664553,3664682-3664777,3665041-3665168, 3665422-3665656,3665743-3665910,3666274-3666381, 3666468-3666617,3666905-3667015,3667118-3667297, 3667427-3667555,3667819-3667914,3668108-3668293, 3668431-3668603,3668720-3668921 Length = 1150 Score = 31.5 bits (68), Expect = 0.44 Identities = 12/26 (46%), Positives = 16/26 (61%) Frame = -1 Query: 286 RCPWSPGAKVEGVLHAVHLVVSYQFV 209 RC WSP + GV + H+V +Y FV Sbjct: 430 RCLWSPDGSILGVAFSKHIVQTYAFV 455 >04_04_0190 - 23442824-23442846,23442891-23442949,23443613-23443737, 23443767-23443901,23444195-23444301,23444488-23444566, 23444856-23444942,23445045-23445281,23445783-23446128, 23446486-23446694 Length = 468 Score = 30.7 bits (66), Expect = 0.77 Identities = 14/33 (42%), Positives = 18/33 (54%) Frame = -1 Query: 310 TQLGNNPGRCPWSPGAKVEGVLHAVHLVVSYQF 212 T G P CP S AKVE HLV++Y++ Sbjct: 411 TPFGGGPRLCPGSELAKVEAAFFLHHLVLNYRW 443 >06_01_0605 + 4373697-4373872,4374840-4374876,4375296-4375399, 4375942-4376137,4376385-4376451,4376895-4376998, 4377090-4377174,4377309-4377369,4377694-4377825, 4377924-4377993,4379261-4379413,4379583-4379694, 4379779-4379920,4380023-4380140,4380862-4380957, 4381061-4381189 Length = 593 Score = 29.5 bits (63), Expect = 1.8 Identities = 23/59 (38%), Positives = 31/59 (52%), Gaps = 2/59 (3%) Frame = +2 Query: 185 SEVITNVVNKLIRNN--KMNCMEYAFNFGSRAPRTSSGIVSQLSSDLSSPKTRLSLCTS 355 SE I+++ N+L R+ K+ C N S A I S+L S LS+ TRL CTS Sbjct: 343 SEFISHLANQLARHQFLKIACQLERKNIAS-AYSLLRVIESELQSYLSAVNTRLGHCTS 400 >06_03_0095 - 16575938-16576585,16577028-16577219,16577294-16577392, 16577496-16577618,16577717-16577929,16578143-16578251, 16578339-16578427,16578604-16578880,16578974-16579084, 16579160-16580508,16581218-16581631 Length = 1207 Score = 29.1 bits (62), Expect = 2.3 Identities = 23/74 (31%), Positives = 35/74 (47%) Frame = -2 Query: 396 ALNIIAQRQSETVALVHKLNRVFGEDKSELNWETIPDDVLGALEPKLKAYSMQFILLFRI 217 +L +IA S + K + + GE K W PDD +PK A + F LL + Sbjct: 316 SLLVIALLGSVLFGIWTKEDLMNGEMK---RWYLRPDDSTIFYDPKRAALASFFHLLTAL 372 Query: 216 SLFTTFVMTSLFFS 175 L++ F+ SL+ S Sbjct: 373 MLYSYFIPISLYIS 386 >12_01_0378 - 2946916-2947590 Length = 224 Score = 28.3 bits (60), Expect = 4.1 Identities = 14/47 (29%), Positives = 27/47 (57%) Frame = +2 Query: 2 GLDSPKMKPAIVILCLFVASLYAADSDVPNDILEEQLYNSVVVADYD 142 G+ ++P +++L ASL AA++ VP + ++ +VV D+D Sbjct: 87 GVHYDAIRPRLLLLLAGGASLGAANATVPGVFHQPRMSTTVVAIDFD 133 >04_04_1212 - 31786063-31786195,31786275-31786398,31786486-31786597, 31786691-31786822,31786929-31787111,31787351-31787479, 31787618-31787788,31788142-31788244,31788628-31788737, 31789158-31789265,31789337-31789512,31790082-31790352, 31790524-31790738,31791042-31792574,31792665-31792728, 31793171-31793251 Length = 1214 Score = 27.5 bits (58), Expect = 7.2 Identities = 20/85 (23%), Positives = 38/85 (44%) Frame = +1 Query: 172 RGEEERSHHKCREQTDTKQQDELHGVRLQLWLQGSKDIVRDCFPVEFRLIFAENAIKLMY 351 R EEER+ + ++ K + E++ +LQ L + + + +E A + +KL Y Sbjct: 455 RKEEERAAMEA-DRAQAKAEVEMNKNKLQNLLNSASRYADNLWYIEPHTYKAGDRVKLFY 513 Query: 352 KRDGLALTLSNDVQGDDGRPAYGDG 426 R L + ++ G + DG Sbjct: 514 NRSSRPLMHNTEIWMHGGYNNWSDG 538 >08_02_0647 - 19687142-19687145,19687244-19689352,19689764-19690617 Length = 988 Score = 27.1 bits (57), Expect = 9.5 Identities = 14/49 (28%), Positives = 27/49 (55%), Gaps = 2/49 (4%) Frame = +2 Query: 92 DILEEQLYNSVVVADY--DSAVEKSKHLYEEKKSEVITNVVNKLIRNNK 232 DIL E LY S ++DY D ++L + + + N++ + ++NN+ Sbjct: 237 DILSEVLYTSNPMSDYQKDHFWRIKENLNQPLEDHQLINMIKEYLKNNR 285 >03_02_0081 - 5506194-5506197,5506310-5507170,5507299-5507456, 5507549-5507740 Length = 404 Score = 27.1 bits (57), Expect = 9.5 Identities = 14/36 (38%), Positives = 21/36 (58%), Gaps = 4/36 (11%) Frame = +1 Query: 397 DDGRPAYGD--GKDK--TSPRVSWKLIALWENNKVY 492 DDGR +G+ G ++ SP SW L +LW+ V+ Sbjct: 233 DDGRWRHGEWRGAERFLASPPASWALASLWDCGGVF 268 >03_01_0300 + 2350232-2352274,2352349-2352669,2352752-2352838, 2353031-2353708,2353800-2353964,2354139-2354433, 2354581-2354795,2354885-2355190,2355269-2355332, 2355426-2355665,2355783-2355886 Length = 1505 Score = 27.1 bits (57), Expect = 9.5 Identities = 9/32 (28%), Positives = 18/32 (56%) Frame = +3 Query: 51 SWHLCMLQIPTSLTTFWRSSFTIASSSPITTV 146 +W + +L +P ++ W + IASS +T + Sbjct: 1080 TWQVLILIVPMAVACMWMQRYYIASSRELTRI 1111 >01_06_1485 + 37703696-37703815,37703970-37704044,37704598-37704699, 37704792-37704845,37705030-37705122,37705215-37705307, 37707150-37707254,37707356-37707454,37707558-37707899 Length = 360 Score = 27.1 bits (57), Expect = 9.5 Identities = 11/23 (47%), Positives = 14/23 (60%) Frame = +1 Query: 1 RTRLSKDEARYSYSMSFRGISVC 69 R R S+DEARY + G+S C Sbjct: 92 RGRFSEDEARYFFQQLICGVSYC 114 >01_05_0487 + 22641133-22642182,22642276-22642863,22642961-22643068, 22643582-22643692,22643784-22643849,22644858-22644917, 22644990-22645119,22645159-22645547,22645783-22645902, 22645957-22646022,22646190-22646255 Length = 917 Score = 27.1 bits (57), Expect = 9.5 Identities = 19/72 (26%), Positives = 41/72 (56%), Gaps = 3/72 (4%) Frame = -2 Query: 441 ACLVLAVAVGRSA--IVALNIIAQRQSETVALVHKLNRVFGEDKSELNWETIPD-DVLGA 271 A LV+ + G A I +LNI+ + +++ + +++K++R+FG W+ P+ + A Sbjct: 512 AILVVDIMRGIQAQTIESLNILKRHKADFIIVLNKVDRLFG-------WKRCPNAPIKKA 564 Query: 270 LEPKLKAYSMQF 235 L+ + + M+F Sbjct: 565 LKQQAEGVKMEF 576 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,995,181 Number of Sequences: 37544 Number of extensions: 236507 Number of successful extensions: 762 Number of sequences better than 10.0: 11 Number of HSP's better than 10.0 without gapping: 749 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 762 length of database: 14,793,348 effective HSP length: 78 effective length of database: 11,864,916 effective search space used: 1186491600 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -