BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbS20247 (548 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g58190.1 68416.m06488 LOB domain protein 29 / lateral organ b... 32 0.29 At2g02910.1 68415.m00240 expressed protein contains Pfam profile... 29 1.5 At3g42630.1 68416.m04430 pentatricopeptide (PPR) repeat-containi... 28 3.6 At1g69890.1 68414.m08043 expressed protein contains Pfam profil... 28 3.6 At1g27100.1 68414.m03303 expressed protein contains Pfam profil... 28 4.7 At5g65510.1 68418.m08241 ovule development protein, putative sim... 27 6.2 At1g61770.1 68414.m06966 DNAJ heat shock N-terminal domain-conta... 27 6.2 At4g28650.1 68417.m04095 leucine-rich repeat transmembrane prote... 27 8.3 At3g10380.1 68416.m01244 exocyst complex component-related ident... 27 8.3 >At3g58190.1 68416.m06488 LOB domain protein 29 / lateral organ boundaries domain protein 29 (LBD29) identical to SP|Q9M2J7 LOB domain protein 29 {Arabidopsis thaliana}; supported by full-length cDNA gi:17227167 Length = 218 Score = 31.9 bits (69), Expect = 0.29 Identities = 23/90 (25%), Positives = 38/90 (42%) Frame = -3 Query: 369 CKTEGSTRRLPASWIFALQKTERLSWHVPSTDFRAVNPYR*RSCANVKYEVRQRSAAHIS 190 C +G++ +F +L H+P +D R + + YE + R + Sbjct: 33 CHEQGASHFAAIHKVFGASNASKLLSHLPISD-------RCEAAITISYEAQAR----LQ 81 Query: 189 DPCVHGESVAFAFSQQKQNVQDEIKFCRQQ 100 DP S FA QQ N+Q E++ +QQ Sbjct: 82 DPIYGCVSHIFALQQQVVNLQAELEILKQQ 111 >At2g02910.1 68415.m00240 expressed protein contains Pfam profile: PF04765 protein of unknown function (DUF616) Length = 460 Score = 29.5 bits (63), Expect = 1.5 Identities = 19/61 (31%), Positives = 30/61 (49%) Frame = -1 Query: 257 RTGSVPVQMSNMRFDNALLHISLILVFMVRASPLLSLNRSKTYRTK*SFAVSNILDALVC 78 +TG VP +S+ F ++ I L + P+L ++ +RTK FA+SN D Sbjct: 274 KTGKVPKFLSHRLFPSSRYSIWLDSKMRLTTDPMLIIDFF-LWRTKSEFAISNHYDRHCV 332 Query: 77 W 75 W Sbjct: 333 W 333 >At3g42630.1 68416.m04430 pentatricopeptide (PPR) repeat-containing protein contains Pfam profile PF01535: PPR repeat Length = 415 Score = 28.3 bits (60), Expect = 3.6 Identities = 16/34 (47%), Positives = 19/34 (55%), Gaps = 1/34 (2%) Frame = -2 Query: 337 CLLDLCFAENREALLART-FDRLSGGKSVPVAFL 239 C L LCFAEN L ART +D + VP F+ Sbjct: 86 CALMLCFAENGFVLRARTIWDEIINSCFVPDVFV 119 >At1g69890.1 68414.m08043 expressed protein contains Pfam profile: PF04601 protein of unknown function (DUF569 Length = 279 Score = 28.3 bits (60), Expect = 3.6 Identities = 14/44 (31%), Positives = 22/44 (50%) Frame = +2 Query: 149 EKAKATLSP*TQGSEICAAERCRTSYLTFAQERYRYGFTARKSV 280 ++A+ + P E+ C +YLT + ER+ G T RK V Sbjct: 38 KRARWIVEPVRGSFEVIRLRSCYGNYLTASNERFLLGATGRKVV 81 >At1g27100.1 68414.m03303 expressed protein contains Pfam profile: PF04601 protein of unknown function (DUF569 Length = 519 Score = 27.9 bits (59), Expect = 4.7 Identities = 12/45 (26%), Positives = 22/45 (48%) Frame = +2 Query: 149 EKAKATLSP*TQGSEICAAERCRTSYLTFAQERYRYGFTARKSVE 283 + A+ T+ P + + C YLT + ER+ G T +K ++ Sbjct: 264 KNARWTVEPVRDSFHVIRLKSCYGKYLTASNERFLLGATGKKVIQ 308 >At5g65510.1 68418.m08241 ovule development protein, putative similar to AINTEGUMENTA (GI:1209099) [Arabidopsis thaliana] Length = 437 Score = 27.5 bits (58), Expect = 6.2 Identities = 14/38 (36%), Positives = 23/38 (60%), Gaps = 3/38 (7%) Frame = -3 Query: 525 DMFSNSIT---GSTHTQTHTVFAITRARLQNSGDVTSS 421 ++F +S T G TH +H V + T A+L +GD T++ Sbjct: 80 EIFDDSTTSNIGGTHLSSHVVESSTTAKLGFNGDCTTT 117 >At1g61770.1 68414.m06966 DNAJ heat shock N-terminal domain-containing protein similar to SP|Q9UBS4 DnaJ homolog subfamily B member 11 precursor Homo sapiens; contains Pfam profile PF00226 DnaJ domain Length = 300 Score = 27.5 bits (58), Expect = 6.2 Identities = 14/41 (34%), Positives = 23/41 (56%) Frame = -1 Query: 458 EHDFRIQETSRVHLHTSPSLRAVFD*LGHGARPKAALVGYL 336 ++D+ I+ V +T+ RA + GH + P+A LVG L Sbjct: 93 QYDYAIEHPEEVFYNTAQYYRAKY---GHKSDPRAVLVGLL 130 >At4g28650.1 68417.m04095 leucine-rich repeat transmembrane protein kinase, putative receptor-like protein kinase 5, Arabidopsis thaliana, PIR1:S27756 Length = 1013 Score = 27.1 bits (57), Expect = 8.3 Identities = 16/54 (29%), Positives = 26/54 (48%), Gaps = 3/54 (5%) Frame = -3 Query: 522 MFSNSITGSTHTQTHTVFAITRARLQN---SGDVTSSFAHITKSPGSIRLAGTR 370 +F+N+ TG T ++ R R+QN +G + F + K + LAG R Sbjct: 387 LFNNTFTGQIPATLSTCQSLVRVRMQNNLLNGSIPIGFGKLEKLQ-RLELAGNR 439 >At3g10380.1 68416.m01244 exocyst complex component-related identical to Probable exocyst complex component Sec8 (Swiss-Prot:Q93YU5) [Arabidopsis thaliana]; weak similarity to Exocyst complex component Sec8 (rSec8) (Swiss-Prot:Q62824) [Rattus norvegicus] Length = 1053 Score = 27.1 bits (57), Expect = 8.3 Identities = 11/26 (42%), Positives = 14/26 (53%) Frame = +2 Query: 206 ERCRTSYLTFAQERYRYGFTARKSVE 283 ERCRTSY+ E+ Y R +E Sbjct: 736 ERCRTSYMEAVLEKLSYMLIGRHDIE 761 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,301,916 Number of Sequences: 28952 Number of extensions: 258161 Number of successful extensions: 818 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 801 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 818 length of database: 12,070,560 effective HSP length: 77 effective length of database: 9,841,256 effective search space used: 1033331880 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -