BLASTX 2.2.12 [Aug-07-2005]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Query= fbS20246
(368 letters)
Database: tribolium
336 sequences; 122,585 total letters
Searching.......................................................done
Score E
Sequences producing significant alignments: (bits) Value
EF592538-1|ABQ95984.1| 582|Tribolium castaneum beta-N-acetylglu... 26 0.14
EF222295-1|ABN79655.1| 146|Tribolium castaneum arginine vasopre... 20 9.2
>EF592538-1|ABQ95984.1| 582|Tribolium castaneum
beta-N-acetylglucosaminidase NAG3 protein.
Length = 582
Score = 25.8 bits (54), Expect = 0.14
Identities = 13/48 (27%), Positives = 23/48 (47%), Gaps = 2/48 (4%)
Frame = -3
Query: 222 LIMFSTCEQTVLTAASSFLD--PNHFSTFRRRGFTMRMSTAKCLKFLL 85
L+MFS + T PN ++ F + +T + KC+K+L+
Sbjct: 11 LLMFSYTDNVSSTRTKYLRTNFPNFYNDFEVQRYTWKCENQKCVKYLV 58
>EF222295-1|ABN79655.1| 146|Tribolium castaneum arginine
vasopressin-like peptide protein.
Length = 146
Score = 19.8 bits (39), Expect = 9.2
Identities = 6/8 (75%), Positives = 7/8 (87%)
Frame = -2
Query: 199 TDCPHGGK 176
T+CP GGK
Sbjct: 24 TNCPRGGK 31
Database: tribolium
Posted date: Oct 23, 2007 1:18 PM
Number of letters in database: 122,585
Number of sequences in database: 336
Lambda K H
0.318 0.134 0.401
Gapped
Lambda K H
0.279 0.0580 0.190
Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 82,045
Number of Sequences: 336
Number of extensions: 1517
Number of successful extensions: 2
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 2
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 2
length of database: 122,585
effective HSP length: 50
effective length of database: 105,785
effective search space used: 7616520
frameshift window, decay const: 40, 0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 39 (20.8 bits)
- SilkBase 1999-2023 -