Bombyx BLAST Result against tribolium

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fbS20246
         (368 letters)

Database: tribolium 
           336 sequences; 122,585 total letters

Searching.......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

EF592538-1|ABQ95984.1|  582|Tribolium castaneum beta-N-acetylglu...    26   0.14 
EF222295-1|ABN79655.1|  146|Tribolium castaneum arginine vasopre...    20   9.2  

>EF592538-1|ABQ95984.1|  582|Tribolium castaneum
           beta-N-acetylglucosaminidase NAG3 protein.
          Length = 582

 Score = 25.8 bits (54), Expect = 0.14
 Identities = 13/48 (27%), Positives = 23/48 (47%), Gaps = 2/48 (4%)
 Frame = -3

Query: 222 LIMFSTCEQTVLTAASSFLD--PNHFSTFRRRGFTMRMSTAKCLKFLL 85
           L+MFS  +    T         PN ++ F  + +T +    KC+K+L+
Sbjct: 11  LLMFSYTDNVSSTRTKYLRTNFPNFYNDFEVQRYTWKCENQKCVKYLV 58


>EF222295-1|ABN79655.1|  146|Tribolium castaneum arginine
           vasopressin-like peptide protein.
          Length = 146

 Score = 19.8 bits (39), Expect = 9.2
 Identities = 6/8 (75%), Positives = 7/8 (87%)
 Frame = -2

Query: 199 TDCPHGGK 176
           T+CP GGK
Sbjct: 24  TNCPRGGK 31


  Database: tribolium
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 122,585
  Number of sequences in database:  336
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 82,045
Number of Sequences: 336
Number of extensions: 1517
Number of successful extensions: 2
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 2
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 2
length of database: 122,585
effective HSP length: 50
effective length of database: 105,785
effective search space used:  7616520
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 39 (20.8 bits)