BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbS20246 (368 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value M93690-2|AAA29363.1| 1212|Anopheles gambiae unknown protein. 25 1.2 AY146732-1|AAO12092.1| 327|Anopheles gambiae odorant-binding pr... 23 4.8 AB090813-2|BAC57902.1| 1099|Anopheles gambiae reverse transcript... 23 4.8 AY943929-1|AAX49502.1| 755|Anopheles gambiae laccase-2 isoform ... 22 6.4 AB090822-2|BAC57920.1| 1173|Anopheles gambiae reverse transcript... 22 6.4 AB097148-2|BAC82628.1| 1077|Anopheles gambiae pol-like protein p... 22 8.4 >M93690-2|AAA29363.1| 1212|Anopheles gambiae unknown protein. Length = 1212 Score = 24.6 bits (51), Expect = 1.2 Identities = 10/20 (50%), Positives = 13/20 (65%) Frame = -3 Query: 216 MFSTCEQTVLTAASSFLDPN 157 M S CE+T+ SSF DP+ Sbjct: 327 MISACEKTMQRMTSSFPDPH 346 >AY146732-1|AAO12092.1| 327|Anopheles gambiae odorant-binding protein AgamOBP44 protein. Length = 327 Score = 22.6 bits (46), Expect = 4.8 Identities = 11/30 (36%), Positives = 15/30 (50%) Frame = -3 Query: 234 LVTPLIMFSTCEQTVLTAASSFLDPNHFST 145 LVTP ++ + C+ L SFL H T Sbjct: 12 LVTPNLIVAECDTKGLIVEKSFLQSVHDCT 41 >AB090813-2|BAC57902.1| 1099|Anopheles gambiae reverse transcriptase protein. Length = 1099 Score = 22.6 bits (46), Expect = 4.8 Identities = 8/21 (38%), Positives = 14/21 (66%) Frame = -3 Query: 219 IMFSTCEQTVLTAASSFLDPN 157 IM +TC++T+ +S DP+ Sbjct: 263 IMLATCDKTMQRVTTSHSDPH 283 >AY943929-1|AAX49502.1| 755|Anopheles gambiae laccase-2 isoform B protein. Length = 755 Score = 22.2 bits (45), Expect = 6.4 Identities = 10/22 (45%), Positives = 13/22 (59%) Frame = -2 Query: 103 VFEVPFENSAGPFNCHQTRFHM 38 V EV EN + PF+ H FH+ Sbjct: 627 VDEVQQENLSHPFHLHGHAFHV 648 >AB090822-2|BAC57920.1| 1173|Anopheles gambiae reverse transcriptase protein. Length = 1173 Score = 22.2 bits (45), Expect = 6.4 Identities = 11/26 (42%), Positives = 13/26 (50%) Frame = -3 Query: 126 TMRMSTAKCLKFLLRTPRGPLTVTRR 49 T + TAK L L+R GP RR Sbjct: 773 TKALRTAKALGCLMRNHSGPKCAKRR 798 >AB097148-2|BAC82628.1| 1077|Anopheles gambiae pol-like protein protein. Length = 1077 Score = 21.8 bits (44), Expect = 8.4 Identities = 9/17 (52%), Positives = 12/17 (70%) Frame = -3 Query: 270 VSIHSXILYWKPLVTPL 220 +S+H ILY PL+T L Sbjct: 653 LSMHLFILYLHPLITRL 669 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 363,097 Number of Sequences: 2352 Number of extensions: 7393 Number of successful extensions: 9 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 9 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 9 length of database: 563,979 effective HSP length: 57 effective length of database: 429,915 effective search space used: 27944475 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -