BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbS20239 (548 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value DQ659254-1|ABG47452.1| 431|Tribolium castaneum imaginal disc gr... 25 0.33 AJ223627-1|CAA11500.1| 371|Tribolium castaneum orthodenticle-1 ... 23 1.3 DQ659253-1|ABG47451.1| 439|Tribolium castaneum imaginal disc gr... 22 3.1 EF222295-1|ABN79655.1| 146|Tribolium castaneum arginine vasopre... 22 4.1 EF125544-1|ABL73928.1| 279|Tribolium castaneum obstractor B pro... 21 9.4 >DQ659254-1|ABG47452.1| 431|Tribolium castaneum imaginal disc growth factor 4 protein. Length = 431 Score = 25.4 bits (53), Expect = 0.33 Identities = 13/51 (25%), Positives = 25/51 (49%) Frame = +1 Query: 343 VATKEALDAKMETHEEKREAYINELRSRLKDHLEGVEKTRLTLEQQTAEVY 495 + + +D K E H+E+ A + E+R+ + +G+ T L + VY Sbjct: 172 IVGESVIDEKAEEHKEQFTALVREIRNAFRH--DGLLLTMSVLPNVNSSVY 220 >AJ223627-1|CAA11500.1| 371|Tribolium castaneum orthodenticle-1 protein protein. Length = 371 Score = 23.4 bits (48), Expect = 1.3 Identities = 12/42 (28%), Positives = 18/42 (42%) Frame = +2 Query: 59 AMEVETKSTEIRCQEMSKGGLAYEVILAEPVGVPVPRRADSP 184 A T T+++ + S V A P G+P P + SP Sbjct: 194 ASRTTTSPTKVKASKASPAAAPRSV--ATPTGIPTPSTSASP 233 Score = 21.8 bits (44), Expect = 4.1 Identities = 10/25 (40%), Positives = 14/25 (56%) Frame = -3 Query: 186 SGESARRGTGTPTGSASITSYARPP 112 S +A R TPTG + ++ A PP Sbjct: 210 SPAAAPRSVATPTGIPTPSTSASPP 234 >DQ659253-1|ABG47451.1| 439|Tribolium castaneum imaginal disc growth factor 2 protein. Length = 439 Score = 22.2 bits (45), Expect = 3.1 Identities = 19/67 (28%), Positives = 25/67 (37%) Frame = +1 Query: 343 VATKEALDAKMETHEEKREAYINELRSRLKDHLEGVEKTRLTLEQQTAEVYKAIEVX*PQ 522 VA + LD H E+ + + ELR K E + T L + VY P Sbjct: 180 VAGDKVLDENAAEHREQFVSLVRELRGAFK--AENLLVTLTVLPNVNSTVYYDPRALSPN 237 Query: 523 LPTSVTE 543 L V E Sbjct: 238 LEFVVLE 244 >EF222295-1|ABN79655.1| 146|Tribolium castaneum arginine vasopressin-like peptide protein. Length = 146 Score = 21.8 bits (44), Expect = 4.1 Identities = 8/27 (29%), Positives = 12/27 (44%) Frame = -1 Query: 524 SCGHXTSMALYTSAVCCSRVNLVFSTP 444 SCG S + ++CC + TP Sbjct: 47 SCGPGQSGQCFGPSICCGPFGCLVGTP 73 >EF125544-1|ABL73928.1| 279|Tribolium castaneum obstractor B protein. Length = 279 Score = 20.6 bits (41), Expect = 9.4 Identities = 10/26 (38%), Positives = 13/26 (50%) Frame = +2 Query: 143 EPVGVPVPRRADSPEKTPSVEEIQEK 220 +P V RR P + VEE +EK Sbjct: 254 KPRPTKVSRRKPRPPRPTQVEEEEEK 279 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 92,118 Number of Sequences: 336 Number of extensions: 1441 Number of successful extensions: 6 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 122,585 effective HSP length: 53 effective length of database: 104,777 effective search space used: 13516233 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -