BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbS20237 (383 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC17G8.07 |||YEATS family protein|Schizosaccharomyces pombe|ch... 26 2.3 SPCC126.09 |||vacuolar membrane zinc transporter |Schizosaccharo... 25 5.4 SPAC2F7.10 |||palmitoyltransferase |Schizosaccharomyces pombe|ch... 24 7.1 SPAC9G1.11c |spn4||septin Spn4|Schizosaccharomyces pombe|chr 1||... 24 7.1 SPAC3A11.06 |mvp1||sorting nexin Mvp1|Schizosaccharomyces pombe|... 24 9.4 >SPAC17G8.07 |||YEATS family protein|Schizosaccharomyces pombe|chr 1|||Manual Length = 217 Score = 25.8 bits (54), Expect = 2.3 Identities = 9/28 (32%), Positives = 19/28 (67%) Frame = -1 Query: 248 ENDRSELVEVLIGEVHVRIRVYFSPDAN 165 E+ E++E GE + +R++F+P+A+ Sbjct: 76 ESPPFEVIETGWGEFDIMVRIFFAPEAH 103 >SPCC126.09 |||vacuolar membrane zinc transporter |Schizosaccharomyces pombe|chr 3|||Manual Length = 418 Score = 24.6 bits (51), Expect = 5.4 Identities = 10/30 (33%), Positives = 19/30 (63%) Frame = +3 Query: 87 GGMSCVKYLMFCFNLLFAITGLIILIVGIR 176 GG+ +L F + ++FA T ++LI+ +R Sbjct: 351 GGIGSSDFLNFLYGIIFAGTAGMMLILSLR 380 >SPAC2F7.10 |||palmitoyltransferase |Schizosaccharomyces pombe|chr 1|||Manual Length = 642 Score = 24.2 bits (50), Expect = 7.1 Identities = 9/22 (40%), Positives = 14/22 (63%) Frame = +3 Query: 108 YLMFCFNLLFAITGLIILIVGI 173 +++FCF F ITG+ I+ I Sbjct: 256 FIIFCFLSSFIITGVFFFIMSI 277 >SPAC9G1.11c |spn4||septin Spn4|Schizosaccharomyces pombe|chr 1|||Manual Length = 380 Score = 24.2 bits (50), Expect = 7.1 Identities = 11/28 (39%), Positives = 15/28 (53%) Frame = -2 Query: 121 QNMRYFTQDIPPSRAIVIQLNITAKLYY 38 Q+ Y QD P R +I + I A LY+ Sbjct: 117 QHESYMRQDQQPDRRKIIDMRIHACLYF 144 >SPAC3A11.06 |mvp1||sorting nexin Mvp1|Schizosaccharomyces pombe|chr 1|||Manual Length = 664 Score = 23.8 bits (49), Expect = 9.4 Identities = 9/39 (23%), Positives = 18/39 (46%) Frame = -2 Query: 175 LMPTIRMINPVMANRRLKQNMRYFTQDIPPSRAIVIQLN 59 ++P ++ NP + NR F + PP+ + L+ Sbjct: 119 VLPILQRFNPELFNRSSDNETPLFPNNSPPASTTALNLS 157 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,501,016 Number of Sequences: 5004 Number of extensions: 25589 Number of successful extensions: 69 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 69 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 69 length of database: 2,362,478 effective HSP length: 65 effective length of database: 2,037,218 effective search space used: 126307516 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -