BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbS20237 (383 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 07_01_1023 + 8840754-8842988,8843189-8843362 27 3.8 06_03_1162 + 28093749-28093851,28093939-28093997,28094691-280947... 27 6.7 03_06_0565 + 34747278-34748066,34748170-34748406,34749777-347498... 26 8.9 >07_01_1023 + 8840754-8842988,8843189-8843362 Length = 802 Score = 27.5 bits (58), Expect = 3.8 Identities = 11/37 (29%), Positives = 20/37 (54%) Frame = -1 Query: 170 ANYQDDQSRNGKQKIEAKHEVLYTGHSTFESHCYSIK 60 A +Q++ ++K+E ++ TG T H YS+K Sbjct: 755 AKHQEEILNCNQRKLEVMDSIMLTGKFTHLQHIYSVK 791 >06_03_1162 + 28093749-28093851,28093939-28093997,28094691-28094766, 28094848-28094919,28095023-28095110,28095230-28095485, 28095583-28095698,28096064-28096127,28096252-28096354, 28096446-28096554,28097048-28097234 Length = 410 Score = 26.6 bits (56), Expect = 6.7 Identities = 12/44 (27%), Positives = 20/44 (45%) Frame = +2 Query: 26 FYSVVIQFGGNI*LNNNGSRRWNVLCKVPHVLLQSSVCHYGIDH 157 F+S+ Q+ G + G W+ L K P ++ S +DH Sbjct: 6 FWSIYYQYEGAVNEGQRGPTIWDTLTKRPGRVIDFSNADVAVDH 49 >03_06_0565 + 34747278-34748066,34748170-34748406,34749777-34749869, 34751752-34751988,34752398-34752584,34752956-34753028, 34753145-34753289,34753670-34753779,34754127-34754258, 34754328-34754469,34754545-34754679,34756278-34756435, 34757327-34757401,34757505-34757643,34757838-34757952, 34758016-34758107,34758500-34758613 Length = 990 Score = 26.2 bits (55), Expect = 8.9 Identities = 10/33 (30%), Positives = 18/33 (54%) Frame = +2 Query: 65 LNNNGSRRWNVLCKVPHVLLQSSVCHYGIDHPD 163 LN+ ++L +PH ++ +CH +DH D Sbjct: 862 LNSTCLHNLSLLSDLPHSTNRTHICHVRLDHID 894 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 9,595,194 Number of Sequences: 37544 Number of extensions: 160728 Number of successful extensions: 324 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 323 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 324 length of database: 14,793,348 effective HSP length: 74 effective length of database: 12,015,092 effective search space used: 636799876 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -