BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbS20237 (383 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY753540-1|AAV28543.1| 3320|Anopheles gambiae SGS3 protein. 25 1.3 AY753539-1|AAV28542.1| 3318|Anopheles gambiae SGS2 protein. 25 1.3 AY280611-1|AAQ21364.1| 1102|Anopheles gambiae chloride/bicarbona... 23 2.9 AY939827-1|AAY18208.1| 680|Anopheles gambiae CTCF-like protein ... 22 6.7 >AY753540-1|AAV28543.1| 3320|Anopheles gambiae SGS3 protein. Length = 3320 Score = 24.6 bits (51), Expect = 1.3 Identities = 13/43 (30%), Positives = 19/43 (44%) Frame = -1 Query: 212 GEVHVRIRVYFSPDANYQDDQSRNGKQKIEAKHEVLYTGHSTF 84 G+V +++R + D D S K H +YTG S F Sbjct: 733 GQVRIQLRDHLGSDTVAVDGSSIPPLGKFPVIHYEMYTGESFF 775 >AY753539-1|AAV28542.1| 3318|Anopheles gambiae SGS2 protein. Length = 3318 Score = 24.6 bits (51), Expect = 1.3 Identities = 13/43 (30%), Positives = 19/43 (44%) Frame = -1 Query: 212 GEVHVRIRVYFSPDANYQDDQSRNGKQKIEAKHEVLYTGHSTF 84 G+V +++R + D D S K H +YTG S F Sbjct: 734 GQVRIQLRDHLGSDTVAVDGSSIPPLGKFPVIHYEMYTGESFF 776 >AY280611-1|AAQ21364.1| 1102|Anopheles gambiae chloride/bicarbonate anion exchanger protein. Length = 1102 Score = 23.4 bits (48), Expect = 2.9 Identities = 13/48 (27%), Positives = 24/48 (50%) Frame = +3 Query: 108 YLMFCFNLLFAITGLIILIVGIRAEINSYPYMNFTDENFYKFAPIVLI 251 YL F F + I+ +++++V + A FT+ENF ++ I Sbjct: 605 YLTFRFWIGTWISIILVVLVAVDASALVCYITRFTEENFACLIAVIFI 652 >AY939827-1|AAY18208.1| 680|Anopheles gambiae CTCF-like protein protein. Length = 680 Score = 22.2 bits (45), Expect = 6.7 Identities = 10/39 (25%), Positives = 18/39 (46%) Frame = -1 Query: 119 KHEVLYTGHSTFESHCYSIKYYRQIVLLRNKMIHTSANK 3 +H ++TG + ++ + L +KMIH NK Sbjct: 257 RHMRIHTGEKPYSCDVCFARFTQSNSLKAHKMIHQVGNK 295 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 384,400 Number of Sequences: 2352 Number of extensions: 6580 Number of successful extensions: 12 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 12 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 12 length of database: 563,979 effective HSP length: 58 effective length of database: 427,563 effective search space used: 29501847 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -