BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbS20236 (618 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value X06905-1|CAA30009.1| 489|Tribolium castaneum protein ( Triboliu... 24 1.2 U04271-2|AAA03709.1| 490|Tribolium castaneum alpha-amylase II p... 24 1.2 EF592539-1|ABQ95985.1| 630|Tribolium castaneum beta-N-acetylglu... 21 6.3 AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase ... 21 6.3 AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase ... 21 6.3 U04271-1|AAA03708.1| 490|Tribolium castaneum alpha-amylase I pr... 21 8.3 AF217810-1|AAF71998.1| 431|Tribolium castaneum fork head orthol... 21 8.3 >X06905-1|CAA30009.1| 489|Tribolium castaneum protein ( Tribolium castaneum mRNAfor alhpa amylase 3'region. ). Length = 489 Score = 23.8 bits (49), Expect = 1.2 Identities = 13/36 (36%), Positives = 17/36 (47%) Frame = -3 Query: 247 LQNTWLRGNQQPRPNAGVSLSIQ*DLGKTLVAHLQT 140 ++N W GNQQ G + +G L HLQT Sbjct: 400 IENWWSDGNQQIAFGRGNKGFVAFTIGYDLNQHLQT 435 >U04271-2|AAA03709.1| 490|Tribolium castaneum alpha-amylase II protein. Length = 490 Score = 23.8 bits (49), Expect = 1.2 Identities = 13/36 (36%), Positives = 17/36 (47%) Frame = -3 Query: 247 LQNTWLRGNQQPRPNAGVSLSIQ*DLGKTLVAHLQT 140 ++N W GNQQ G + +G L HLQT Sbjct: 401 IENWWSDGNQQIAFGRGNKGFVAFTIGYDLNQHLQT 436 >EF592539-1|ABQ95985.1| 630|Tribolium castaneum beta-N-acetylglucosaminidase FDL protein. Length = 630 Score = 21.4 bits (43), Expect = 6.3 Identities = 9/38 (23%), Positives = 18/38 (47%) Frame = +1 Query: 421 TDSPGPTPTIYRHTLTSCYS*TLKLNSTRNI*EHQQDL 534 TD+P P T+ H+ + + + L ++ E D+ Sbjct: 117 TDTPEPARTLLEHSFVAFNTNIISLVQNKDYVERDTDI 154 >AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase protein. Length = 1464 Score = 21.4 bits (43), Expect = 6.3 Identities = 12/35 (34%), Positives = 17/35 (48%), Gaps = 1/35 (2%) Frame = +3 Query: 462 IDQLLQLNSEIEQHEEYLRASAGPSKLRL-PRCLE 563 IDQ L LN +++ R+ GP L P +E Sbjct: 493 IDQSLALNRRRDENPRNYRSDEGPQITELEPETIE 527 >AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase CHS2 protein. Length = 1464 Score = 21.4 bits (43), Expect = 6.3 Identities = 12/35 (34%), Positives = 17/35 (48%), Gaps = 1/35 (2%) Frame = +3 Query: 462 IDQLLQLNSEIEQHEEYLRASAGPSKLRL-PRCLE 563 IDQ L LN +++ R+ GP L P +E Sbjct: 493 IDQSLALNRRRDENPRNYRSDEGPQITELEPETIE 527 >U04271-1|AAA03708.1| 490|Tribolium castaneum alpha-amylase I protein. Length = 490 Score = 21.0 bits (42), Expect = 8.3 Identities = 11/36 (30%), Positives = 16/36 (44%) Frame = -3 Query: 247 LQNTWLRGNQQPRPNAGVSLSIQ*DLGKTLVAHLQT 140 ++N W GNQQ G + +G L H +T Sbjct: 401 IENWWSDGNQQIAFGRGNKGFVAFTIGYDLNQHFET 436 >AF217810-1|AAF71998.1| 431|Tribolium castaneum fork head orthologue protein. Length = 431 Score = 21.0 bits (42), Expect = 8.3 Identities = 7/19 (36%), Positives = 11/19 (57%) Frame = -3 Query: 469 WSMYACISSVLARGCLLRR 413 WS++ ++ GC LRR Sbjct: 214 WSLHPDSGNMFENGCYLRR 232 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 152,591 Number of Sequences: 336 Number of extensions: 3204 Number of successful extensions: 7 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 122,585 effective HSP length: 54 effective length of database: 104,441 effective search space used: 15770591 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -