BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbS20235 (445 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_34063| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 9e-08 SB_14956| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 3e-04 SB_14435| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 3e-04 SB_5286| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 4e-04 SB_6886| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 5e-04 SB_15537| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 7e-04 SB_59238| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.001 SB_41956| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.001 SB_24159| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.001 SB_4735| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.001 SB_57030| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.001 SB_56967| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.001 SB_51740| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.001 SB_47445| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.001 SB_44379| Best HMM Match : Peptidase_M28 (HMM E-Value=6.6e-11) 40 0.001 SB_43731| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.001 SB_41197| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.001 SB_24786| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.001 SB_24487| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.001 SB_17901| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.001 SB_14039| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.001 SB_8422| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.001 SB_1805| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.001 SB_57745| Best HMM Match : Extensin_2 (HMM E-Value=0.69) 40 0.001 SB_57204| Best HMM Match : DUF765 (HMM E-Value=9.1) 40 0.001 SB_56430| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.001 SB_50135| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.001 SB_30644| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.001 SB_25921| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.001 SB_58927| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.001 SB_54757| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.001 SB_53089| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.001 SB_50032| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.001 SB_47635| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.001 SB_45427| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.001 SB_43613| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.001 SB_43412| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.001 SB_37910| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.001 SB_31357| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.001 SB_31108| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.001 SB_26762| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.001 SB_21994| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.001 SB_17082| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.001 SB_12793| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.001 SB_9035| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.001 SB_8174| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.001 SB_4857| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.001 SB_4560| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.001 SB_13544| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.002 SB_3677| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.002 SB_55041| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.002 SB_45525| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.002 SB_41071| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.002 SB_23012| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.002 SB_19004| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.002 SB_12358| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.002 SB_9177| Best HMM Match : PPI_Ypi1 (HMM E-Value=1.9) 39 0.002 SB_7956| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.002 SB_5582| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.002 SB_49285| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.002 SB_46691| Best HMM Match : DUF765 (HMM E-Value=9.5) 39 0.002 SB_41066| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.002 SB_38948| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.002 SB_33475| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.002 SB_30432| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.002 SB_1988| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.002 SB_1420| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.002 SB_50748| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.002 SB_50652| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.002 SB_50465| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.002 SB_47807| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.002 SB_47618| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.002 SB_44913| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.002 SB_39514| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.002 SB_38641| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.002 SB_36087| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.002 SB_33697| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.002 SB_22981| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.002 SB_16374| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.002 SB_15205| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.002 SB_14826| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.002 SB_13552| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.002 SB_9210| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.002 SB_7598| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.002 SB_6726| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.002 SB_5856| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.002 SB_1971| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.002 SB_56744| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.003 SB_52638| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.003 SB_49418| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.003 SB_44516| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.003 SB_39503| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.003 SB_30594| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.003 SB_25680| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.003 SB_22621| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.003 SB_21689| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.003 SB_21022| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.003 SB_19244| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.003 SB_16794| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.003 SB_12111| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.003 SB_8996| Best HMM Match : DUF765 (HMM E-Value=7.2) 38 0.003 SB_8988| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.003 SB_8663| Best HMM Match : DUF250 (HMM E-Value=9.3e-05) 38 0.003 SB_5162| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.003 SB_57591| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.003 SB_56961| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.003 SB_55315| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.003 SB_54105| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.003 SB_52710| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.003 SB_50444| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.003 SB_49677| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.003 SB_48334| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.003 SB_46485| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.003 SB_46149| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.003 SB_45536| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.003 SB_45377| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.003 SB_43133| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.003 SB_42589| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.003 SB_40102| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.003 SB_38659| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.003 SB_38151| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.003 SB_37939| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.003 SB_36967| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.003 SB_35822| Best HMM Match : DUF765 (HMM E-Value=3.3) 38 0.003 SB_34503| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.003 SB_32645| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.003 SB_32565| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.003 SB_30829| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.003 SB_30632| Best HMM Match : Acyltransferase (HMM E-Value=0.0097) 38 0.003 SB_30574| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.003 SB_29978| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.003 SB_28515| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.003 SB_26694| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.003 SB_25053| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.003 SB_23700| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.003 SB_21779| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.003 SB_21702| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.003 SB_21233| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.003 SB_19926| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.003 SB_19315| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.003 SB_19181| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.003 SB_16330| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.003 SB_14766| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.003 SB_14383| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.003 SB_13084| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.003 SB_12674| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.003 SB_12453| Best HMM Match : DUF765 (HMM E-Value=5) 38 0.003 SB_9975| Best HMM Match : 7tm_2 (HMM E-Value=1.9e-38) 38 0.003 SB_9111| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.003 SB_9069| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.003 SB_8550| Best HMM Match : MASE1 (HMM E-Value=1.5) 38 0.003 SB_7969| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.003 SB_6839| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.003 SB_3006| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.003 SB_2671| Best HMM Match : Amidohydro_2 (HMM E-Value=5.6) 38 0.003 SB_2190| Best HMM Match : SGS (HMM E-Value=2.5) 38 0.003 SB_1535| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.003 SB_516| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.003 SB_56764| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.004 SB_56737| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.004 SB_54029| Best HMM Match : DUF765 (HMM E-Value=6.6) 38 0.004 SB_50722| Best HMM Match : Cullin (HMM E-Value=1.2e-20) 38 0.004 SB_48217| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.004 SB_40614| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.004 SB_40583| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.004 SB_39247| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.004 SB_25891| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.004 SB_25598| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.004 SB_23442| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.004 SB_22452| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.004 SB_20710| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.004 SB_18012| Best HMM Match : Flavoprotein (HMM E-Value=4.4) 38 0.004 SB_15611| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.004 SB_14916| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.004 SB_13329| Best HMM Match : C1_2 (HMM E-Value=7.3) 38 0.004 SB_13100| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.004 SB_10491| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.004 SB_58800| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.004 SB_58307| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.004 SB_56302| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.004 SB_53743| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.004 SB_53325| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.004 SB_51146| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.004 SB_50042| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.004 SB_46709| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.004 SB_45457| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.004 SB_45434| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.004 SB_45157| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.004 SB_43874| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.004 SB_42996| Best HMM Match : Neur_chan_memb (HMM E-Value=0.14) 38 0.004 SB_37610| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.004 SB_37411| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.004 SB_31700| Best HMM Match : RNA_pol_Rpb1_R (HMM E-Value=6.8) 38 0.004 SB_29275| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.004 SB_27295| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.004 SB_27058| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.004 SB_26956| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.004 SB_26923| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.004 SB_17821| Best HMM Match : PQ-loop (HMM E-Value=6.7) 38 0.004 SB_17198| Best HMM Match : HEAT (HMM E-Value=1.8e-15) 38 0.004 SB_17162| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.004 SB_13387| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.004 SB_9854| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.004 SB_9296| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.004 SB_9153| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.004 SB_8232| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.004 SB_5754| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.004 SB_4657| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.004 SB_4523| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.004 SB_3515| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.004 SB_1885| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.004 SB_1863| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.004 SB_524| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.004 SB_454| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.004 SB_379| Best HMM Match : ADK (HMM E-Value=3.2e-05) 38 0.004 SB_57778| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_56876| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_52366| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_43510| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_31351| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_30600| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_26393| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_25442| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_19569| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_12760| Best HMM Match : DUF765 (HMM E-Value=6.2) 38 0.005 SB_8543| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_7024| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_2138| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_1239| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_58683| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_58005| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_54339| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_52100| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_50614| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_49201| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_48738| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_48029| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_46641| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_45361| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_45029| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_43466| Best HMM Match : DEAD (HMM E-Value=1.8) 38 0.005 SB_43244| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_40073| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_37676| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_36435| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_35028| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_33980| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_33166| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_32912| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_32750| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_32567| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_30656| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_30165| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_27903| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_26870| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_23203| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_20053| Best HMM Match : DUF765 (HMM E-Value=3.9) 38 0.005 SB_19538| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_17859| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_16339| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_15848| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_15013| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_13185| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_12908| Best HMM Match : Drf_FH1 (HMM E-Value=4.9) 38 0.005 SB_12282| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_9445| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_4499| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_4204| Best HMM Match : DUF765 (HMM E-Value=8) 38 0.005 SB_1746| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_59604| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.007 SB_59460| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.007 SB_59373| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.007 SB_58736| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.007 SB_58703| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.007 SB_58695| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.007 SB_58088| Best HMM Match : HLH (HMM E-Value=3e-12) 37 0.007 SB_58079| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.007 SB_57318| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.007 SB_57084| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.007 SB_56806| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.007 SB_55811| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.007 SB_55776| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.007 SB_55320| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.007 SB_54883| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.007 SB_54473| Best HMM Match : DLIC (HMM E-Value=0) 37 0.007 SB_54089| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.007 SB_53407| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.007 SB_53265| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.007 SB_52760| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.007 SB_52630| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.007 SB_52493| Best HMM Match : DUF765 (HMM E-Value=9.6) 37 0.007 SB_52302| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.007 SB_52283| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.007 SB_51095| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.007 SB_50900| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.007 SB_50524| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.007 SB_50060| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.007 SB_49788| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.007 SB_49256| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.007 SB_49040| Best HMM Match : SlyX (HMM E-Value=7.1) 37 0.007 SB_49017| Best HMM Match : DUF765 (HMM E-Value=1.8) 37 0.007 SB_48718| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.007 SB_48039| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.007 SB_48026| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.007 SB_47315| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.007 SB_47208| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.007 SB_46651| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.007 SB_46361| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.007 SB_46321| Best HMM Match : DUF765 (HMM E-Value=3.4) 37 0.007 SB_45068| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.007 SB_44900| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.007 SB_44829| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.007 SB_44778| Best HMM Match : TPR_2 (HMM E-Value=0.00023) 37 0.007 SB_44497| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.007 SB_44312| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.007 SB_43960| Best HMM Match : Toxin_19 (HMM E-Value=0.56) 37 0.007 SB_43098| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.007 SB_42924| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.007 SB_42730| Best HMM Match : Ank (HMM E-Value=0.00016) 37 0.007 SB_42646| Best HMM Match : DUF765 (HMM E-Value=5.8) 37 0.007 SB_42337| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.007 SB_42175| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.007 SB_41568| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.007 SB_41112| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.007 SB_41011| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.007 SB_40862| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.007 SB_40550| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.007 SB_40465| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.007 SB_39690| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.007 SB_39280| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.007 SB_38767| Best HMM Match : Filamin (HMM E-Value=0.034) 37 0.007 SB_38675| Best HMM Match : HEAT (HMM E-Value=0.0016) 37 0.007 SB_38504| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.007 SB_38078| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.007 SB_37066| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.007 SB_37030| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.007 SB_36958| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.007 SB_36941| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.007 SB_36841| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.007 SB_35988| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.007 SB_35732| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.007 SB_35026| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.007 SB_33934| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.007 SB_33698| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.007 SB_32832| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.007 SB_31818| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.007 SB_31375| Best HMM Match : IQ (HMM E-Value=0.00076) 37 0.007 SB_31367| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.007 SB_31127| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.007 SB_30978| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.007 SB_30336| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.007 SB_29954| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.007 SB_29285| Best HMM Match : DUF1201 (HMM E-Value=2.4) 37 0.007 SB_29217| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.007 SB_29207| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.007 SB_28825| Best HMM Match : COX8 (HMM E-Value=4.5) 37 0.007 SB_28582| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.007 SB_28324| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.007 SB_28058| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.007 SB_28014| Best HMM Match : HOOK (HMM E-Value=1.8e-13) 37 0.007 SB_27874| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.007 SB_27108| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.007 SB_26533| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.007 SB_26464| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.007 SB_25575| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.007 SB_25166| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.007 SB_24822| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.007 SB_24611| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.007 SB_24337| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.007 SB_24316| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.007 SB_23160| Best HMM Match : DUF1136 (HMM E-Value=9.6) 37 0.007 SB_21861| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.007 SB_21569| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.007 SB_21366| Best HMM Match : YL1 (HMM E-Value=6.4) 37 0.007 SB_21293| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.007 SB_20337| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.007 SB_20204| Best HMM Match : UCR_TM (HMM E-Value=9.9) 37 0.007 SB_20039| Best HMM Match : LRR_1 (HMM E-Value=0.0061) 37 0.007 SB_19659| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.007 SB_19301| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.007 SB_19273| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.007 SB_18823| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.007 SB_18484| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.007 SB_17987| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.007 SB_17701| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.007 SB_16326| Best HMM Match : Sushi (HMM E-Value=5.4e-18) 37 0.007 SB_15961| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.007 SB_15454| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.007 SB_15339| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.007 SB_15306| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.007 SB_14529| Best HMM Match : S10_plectin (HMM E-Value=5.8) 37 0.007 SB_14523| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.007 SB_14086| Best HMM Match : POR (HMM E-Value=7.7) 37 0.007 SB_13840| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.007 SB_13728| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.007 SB_13641| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.007 SB_13399| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.007 SB_13203| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.007 SB_13008| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.007 SB_12959| Best HMM Match : Peptidase_M16_C (HMM E-Value=1e-14) 37 0.007 SB_12705| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.007 SB_12153| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.007 SB_11081| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.007 SB_10608| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.007 SB_10567| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.007 SB_9985| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.007 SB_8860| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.007 SB_8846| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.007 SB_8191| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.007 SB_7929| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.007 SB_7925| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.007 SB_7839| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.007 SB_7837| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.007 SB_7552| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.007 SB_7340| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.007 SB_7279| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.007 SB_7158| Best HMM Match : Copper-fist (HMM E-Value=7.1) 37 0.007 SB_6846| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.007 SB_6413| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.007 SB_6345| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.007 SB_5250| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.007 SB_4586| Best HMM Match : DUF765 (HMM E-Value=7) 37 0.007 SB_4437| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.007 SB_4105| Best HMM Match : WAP (HMM E-Value=0.0002) 37 0.007 SB_3970| Best HMM Match : Drf_FH1 (HMM E-Value=1.2) 37 0.007 SB_3149| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.007 SB_2915| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.007 SB_2869| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.007 SB_2426| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.007 SB_2195| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.007 SB_1540| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.007 SB_1195| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.007 SB_753| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.007 SB_59788| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.007 SB_59569| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.007 SB_59539| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.007 SB_59510| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.007 SB_58686| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.007 SB_58350| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.007 SB_58237| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.007 SB_57700| Best HMM Match : Parecho_VpG (HMM E-Value=7.7) 37 0.007 SB_56965| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.007 SB_56894| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.007 SB_56871| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.007 SB_56822| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.007 SB_56549| Best HMM Match : Spermine_synth (HMM E-Value=1.5e-29) 37 0.007 SB_55765| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.007 SB_55260| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.007 SB_55243| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.007 SB_55208| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.007 SB_55206| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.007 SB_55086| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.007 SB_55000| Best HMM Match : DUF765 (HMM E-Value=3.9) 37 0.007 SB_54502| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.007 SB_54383| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.007 SB_54347| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.007 SB_54313| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.007 SB_53934| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.007 SB_53848| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.007 SB_53639| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.007 SB_53581| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.007 SB_53521| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.007 SB_53415| Best HMM Match : efhand (HMM E-Value=2.7e-12) 37 0.007 SB_53321| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.007 SB_53245| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.007 SB_52926| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.007 SB_52745| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.007 SB_52722| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.007 SB_52633| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.007 SB_52596| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.007 SB_52563| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.007 SB_52392| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.007 SB_52165| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.007 SB_52028| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.007 SB_51470| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.007 SB_51469| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.007 SB_51374| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.007 SB_50800| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.007 SB_50750| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.007 SB_50670| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.007 SB_49519| Best HMM Match : DUF1378 (HMM E-Value=8.8) 37 0.007 SB_49267| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.007 SB_49082| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.007 SB_48925| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.007 SB_48900| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.007 SB_48897| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.007 SB_48730| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.007 SB_48557| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.007 SB_48356| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.007 SB_48297| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.007 SB_48240| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.007 SB_47996| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.007 SB_47825| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.007 SB_47774| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.007 SB_47610| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.007 SB_47580| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.007 SB_47576| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.007 SB_47430| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.007 SB_47151| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.007 SB_47128| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.007 >SB_34063| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 886 Score = 53.2 bits (122), Expect = 9e-08 Identities = 26/40 (65%), Positives = 31/40 (77%), Gaps = 1/40 (2%) Frame = +3 Query: 141 IKEGQAQICLTTEK-VFYNPVQEFNRDLSIAVLTLFIEDI 257 I+EG+A+I EK VFYNPVQEFNRD+S AV+ L EDI Sbjct: 118 IREGKAEIIFPAEKAVFYNPVQEFNRDISSAVIRLVCEDI 157 Score = 44.8 bits (101), Expect = 3e-05 Identities = 19/34 (55%), Positives = 28/34 (82%) Frame = +2 Query: 344 KITILEALSATGLXSIRYAKEIPYATNIIANDLS 445 ++TILE L+A+GL S+RYA E+P ++IAND+S Sbjct: 187 QVTILEGLAASGLRSVRYALEVPGIHHVIANDIS 220 >SB_14956| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 41.5 bits (93), Expect = 3e-04 Identities = 17/21 (80%), Positives = 18/21 (85%) Frame = -3 Query: 92 GLVPNSCSPGDPLVLEXPPGR 30 G+V NSCSPGDPLVLE PP R Sbjct: 5 GIVSNSCSPGDPLVLERPPPR 25 >SB_14435| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 234 Score = 41.5 bits (93), Expect = 3e-04 Identities = 17/22 (77%), Positives = 17/22 (77%) Frame = -3 Query: 95 NGLVPNSCSPGDPLVLEXPPGR 30 NG NSCSPGDPLVLE PP R Sbjct: 107 NGFTSNSCSPGDPLVLERPPPR 128 >SB_5286| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 41.1 bits (92), Expect = 4e-04 Identities = 17/22 (77%), Positives = 18/22 (81%) Frame = -3 Query: 95 NGLVPNSCSPGDPLVLEXPPGR 30 +GL NSCSPGDPLVLE PP R Sbjct: 9 SGLTSNSCSPGDPLVLERPPPR 30 >SB_6886| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 202 Score = 40.7 bits (91), Expect = 5e-04 Identities = 17/22 (77%), Positives = 18/22 (81%) Frame = -3 Query: 95 NGLVPNSCSPGDPLVLEXPPGR 30 N +V NSCSPGDPLVLE PP R Sbjct: 75 NTIVSNSCSPGDPLVLERPPPR 96 >SB_15537| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 40.3 bits (90), Expect = 7e-04 Identities = 19/24 (79%), Positives = 19/24 (79%), Gaps = 2/24 (8%) Frame = -3 Query: 95 NGLVP--NSCSPGDPLVLEXPPGR 30 NGL P NSCSPGDPLVLE PP R Sbjct: 20 NGLSPGSNSCSPGDPLVLERPPPR 43 >SB_59238| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 39.9 bits (89), Expect = 0.001 Identities = 17/20 (85%), Positives = 17/20 (85%) Frame = -3 Query: 89 LVPNSCSPGDPLVLEXPPGR 30 LV NSCSPGDPLVLE PP R Sbjct: 24 LVSNSCSPGDPLVLERPPPR 43 >SB_41956| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 39.9 bits (89), Expect = 0.001 Identities = 17/20 (85%), Positives = 17/20 (85%) Frame = -3 Query: 89 LVPNSCSPGDPLVLEXPPGR 30 LV NSCSPGDPLVLE PP R Sbjct: 3 LVSNSCSPGDPLVLERPPPR 22 >SB_24159| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 39.9 bits (89), Expect = 0.001 Identities = 17/20 (85%), Positives = 17/20 (85%) Frame = -3 Query: 89 LVPNSCSPGDPLVLEXPPGR 30 LV NSCSPGDPLVLE PP R Sbjct: 17 LVSNSCSPGDPLVLERPPPR 36 >SB_4735| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 39.9 bits (89), Expect = 0.001 Identities = 16/21 (76%), Positives = 18/21 (85%) Frame = -3 Query: 92 GLVPNSCSPGDPLVLEXPPGR 30 G++ NSCSPGDPLVLE PP R Sbjct: 32 GVLSNSCSPGDPLVLERPPPR 52 >SB_57030| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 39.9 bits (89), Expect = 0.001 Identities = 17/21 (80%), Positives = 17/21 (80%) Frame = -3 Query: 92 GLVPNSCSPGDPLVLEXPPGR 30 GL NSCSPGDPLVLE PP R Sbjct: 5 GLPSNSCSPGDPLVLERPPPR 25 >SB_56967| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 39.9 bits (89), Expect = 0.001 Identities = 17/20 (85%), Positives = 17/20 (85%) Frame = -3 Query: 89 LVPNSCSPGDPLVLEXPPGR 30 LV NSCSPGDPLVLE PP R Sbjct: 9 LVSNSCSPGDPLVLERPPPR 28 >SB_51740| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 39.9 bits (89), Expect = 0.001 Identities = 17/22 (77%), Positives = 17/22 (77%) Frame = -3 Query: 95 NGLVPNSCSPGDPLVLEXPPGR 30 N L NSCSPGDPLVLE PP R Sbjct: 4 NTLASNSCSPGDPLVLERPPPR 25 >SB_47445| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 135 Score = 39.9 bits (89), Expect = 0.001 Identities = 17/22 (77%), Positives = 17/22 (77%) Frame = -3 Query: 95 NGLVPNSCSPGDPLVLEXPPGR 30 N V NSCSPGDPLVLE PP R Sbjct: 8 NDAVSNSCSPGDPLVLERPPPR 29 >SB_44379| Best HMM Match : Peptidase_M28 (HMM E-Value=6.6e-11) Length = 1098 Score = 39.9 bits (89), Expect = 0.001 Identities = 17/24 (70%), Positives = 18/24 (75%) Frame = -3 Query: 101 R*NGLVPNSCSPGDPLVLEXPPGR 30 R G + NSCSPGDPLVLE PP R Sbjct: 969 RRKGWISNSCSPGDPLVLERPPPR 992 >SB_43731| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 39.9 bits (89), Expect = 0.001 Identities = 17/20 (85%), Positives = 17/20 (85%) Frame = -3 Query: 89 LVPNSCSPGDPLVLEXPPGR 30 LV NSCSPGDPLVLE PP R Sbjct: 5 LVSNSCSPGDPLVLERPPPR 24 >SB_41197| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 39.9 bits (89), Expect = 0.001 Identities = 17/20 (85%), Positives = 17/20 (85%) Frame = -3 Query: 89 LVPNSCSPGDPLVLEXPPGR 30 LV NSCSPGDPLVLE PP R Sbjct: 2 LVSNSCSPGDPLVLERPPPR 21 >SB_24786| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 151 Score = 39.9 bits (89), Expect = 0.001 Identities = 17/20 (85%), Positives = 17/20 (85%) Frame = -3 Query: 89 LVPNSCSPGDPLVLEXPPGR 30 LV NSCSPGDPLVLE PP R Sbjct: 26 LVSNSCSPGDPLVLERPPPR 45 >SB_24487| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 177 Score = 39.9 bits (89), Expect = 0.001 Identities = 17/22 (77%), Positives = 17/22 (77%) Frame = -3 Query: 95 NGLVPNSCSPGDPLVLEXPPGR 30 NG NSCSPGDPLVLE PP R Sbjct: 50 NGSESNSCSPGDPLVLERPPPR 71 >SB_17901| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 151 Score = 39.9 bits (89), Expect = 0.001 Identities = 17/20 (85%), Positives = 17/20 (85%) Frame = -3 Query: 89 LVPNSCSPGDPLVLEXPPGR 30 LV NSCSPGDPLVLE PP R Sbjct: 26 LVSNSCSPGDPLVLERPPPR 45 >SB_14039| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 39.9 bits (89), Expect = 0.001 Identities = 17/22 (77%), Positives = 17/22 (77%) Frame = -3 Query: 95 NGLVPNSCSPGDPLVLEXPPGR 30 N V NSCSPGDPLVLE PP R Sbjct: 15 NAKVSNSCSPGDPLVLERPPPR 36 >SB_8422| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 39.9 bits (89), Expect = 0.001 Identities = 16/21 (76%), Positives = 17/21 (80%) Frame = -3 Query: 92 GLVPNSCSPGDPLVLEXPPGR 30 G+ NSCSPGDPLVLE PP R Sbjct: 2 GITSNSCSPGDPLVLERPPPR 22 >SB_1805| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 39.9 bits (89), Expect = 0.001 Identities = 17/21 (80%), Positives = 17/21 (80%) Frame = -3 Query: 92 GLVPNSCSPGDPLVLEXPPGR 30 GL NSCSPGDPLVLE PP R Sbjct: 2 GLQSNSCSPGDPLVLERPPPR 22 >SB_57745| Best HMM Match : Extensin_2 (HMM E-Value=0.69) Length = 472 Score = 39.5 bits (88), Expect = 0.001 Identities = 16/22 (72%), Positives = 18/22 (81%) Frame = -3 Query: 95 NGLVPNSCSPGDPLVLEXPPGR 30 + +V NSCSPGDPLVLE PP R Sbjct: 345 HSIVSNSCSPGDPLVLERPPPR 366 >SB_57204| Best HMM Match : DUF765 (HMM E-Value=9.1) Length = 129 Score = 39.5 bits (88), Expect = 0.001 Identities = 16/22 (72%), Positives = 17/22 (77%) Frame = -3 Query: 95 NGLVPNSCSPGDPLVLEXPPGR 30 N + NSCSPGDPLVLE PP R Sbjct: 2 NAQISNSCSPGDPLVLERPPPR 23 >SB_56430| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 39.5 bits (88), Expect = 0.001 Identities = 16/20 (80%), Positives = 17/20 (85%) Frame = -3 Query: 89 LVPNSCSPGDPLVLEXPPGR 30 L+ NSCSPGDPLVLE PP R Sbjct: 33 LISNSCSPGDPLVLERPPPR 52 >SB_50135| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 39.5 bits (88), Expect = 0.001 Identities = 16/20 (80%), Positives = 17/20 (85%) Frame = -3 Query: 89 LVPNSCSPGDPLVLEXPPGR 30 L+ NSCSPGDPLVLE PP R Sbjct: 17 LISNSCSPGDPLVLERPPPR 36 >SB_30644| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1887 Score = 39.5 bits (88), Expect = 0.001 Identities = 17/21 (80%), Positives = 17/21 (80%) Frame = -3 Query: 92 GLVPNSCSPGDPLVLEXPPGR 30 GL NSCSPGDPLVLE PP R Sbjct: 1019 GLGSNSCSPGDPLVLERPPPR 1039 >SB_25921| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 162 Score = 39.5 bits (88), Expect = 0.001 Identities = 16/20 (80%), Positives = 17/20 (85%) Frame = -3 Query: 89 LVPNSCSPGDPLVLEXPPGR 30 L+ NSCSPGDPLVLE PP R Sbjct: 37 LISNSCSPGDPLVLERPPPR 56 >SB_58927| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 39.5 bits (88), Expect = 0.001 Identities = 16/20 (80%), Positives = 17/20 (85%) Frame = -3 Query: 89 LVPNSCSPGDPLVLEXPPGR 30 L+ NSCSPGDPLVLE PP R Sbjct: 8 LISNSCSPGDPLVLERPPPR 27 >SB_54757| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 39.5 bits (88), Expect = 0.001 Identities = 16/20 (80%), Positives = 17/20 (85%) Frame = -3 Query: 89 LVPNSCSPGDPLVLEXPPGR 30 L+ NSCSPGDPLVLE PP R Sbjct: 33 LISNSCSPGDPLVLERPPPR 52 >SB_53089| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 139 Score = 39.5 bits (88), Expect = 0.001 Identities = 16/22 (72%), Positives = 18/22 (81%) Frame = -3 Query: 95 NGLVPNSCSPGDPLVLEXPPGR 30 N ++ NSCSPGDPLVLE PP R Sbjct: 12 NIIISNSCSPGDPLVLERPPPR 33 >SB_50032| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 39.5 bits (88), Expect = 0.001 Identities = 16/20 (80%), Positives = 17/20 (85%) Frame = -3 Query: 89 LVPNSCSPGDPLVLEXPPGR 30 L+ NSCSPGDPLVLE PP R Sbjct: 33 LISNSCSPGDPLVLERPPPR 52 >SB_47635| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 39.5 bits (88), Expect = 0.001 Identities = 16/20 (80%), Positives = 17/20 (85%) Frame = -3 Query: 89 LVPNSCSPGDPLVLEXPPGR 30 L+ NSCSPGDPLVLE PP R Sbjct: 33 LISNSCSPGDPLVLERPPPR 52 >SB_45427| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 39.5 bits (88), Expect = 0.001 Identities = 16/20 (80%), Positives = 17/20 (85%) Frame = -3 Query: 89 LVPNSCSPGDPLVLEXPPGR 30 L+ NSCSPGDPLVLE PP R Sbjct: 24 LISNSCSPGDPLVLERPPPR 43 >SB_43613| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 39.5 bits (88), Expect = 0.001 Identities = 16/20 (80%), Positives = 17/20 (85%) Frame = -3 Query: 89 LVPNSCSPGDPLVLEXPPGR 30 L+ NSCSPGDPLVLE PP R Sbjct: 33 LISNSCSPGDPLVLERPPPR 52 >SB_43412| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 39.5 bits (88), Expect = 0.001 Identities = 16/20 (80%), Positives = 17/20 (85%) Frame = -3 Query: 89 LVPNSCSPGDPLVLEXPPGR 30 L+ NSCSPGDPLVLE PP R Sbjct: 33 LISNSCSPGDPLVLERPPPR 52 >SB_37910| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 137 Score = 39.5 bits (88), Expect = 0.001 Identities = 18/22 (81%), Positives = 18/22 (81%), Gaps = 1/22 (4%) Frame = -3 Query: 92 GLVP-NSCSPGDPLVLEXPPGR 30 G VP NSCSPGDPLVLE PP R Sbjct: 10 GFVPSNSCSPGDPLVLERPPPR 31 >SB_31357| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 165 Score = 39.5 bits (88), Expect = 0.001 Identities = 16/20 (80%), Positives = 17/20 (85%) Frame = -3 Query: 89 LVPNSCSPGDPLVLEXPPGR 30 L+ NSCSPGDPLVLE PP R Sbjct: 40 LISNSCSPGDPLVLERPPPR 59 >SB_31108| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 39.5 bits (88), Expect = 0.001 Identities = 16/20 (80%), Positives = 17/20 (85%) Frame = -3 Query: 89 LVPNSCSPGDPLVLEXPPGR 30 L+ NSCSPGDPLVLE PP R Sbjct: 33 LISNSCSPGDPLVLERPPPR 52 >SB_26762| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 195 Score = 39.5 bits (88), Expect = 0.001 Identities = 16/20 (80%), Positives = 17/20 (85%) Frame = -3 Query: 89 LVPNSCSPGDPLVLEXPPGR 30 L+ NSCSPGDPLVLE PP R Sbjct: 70 LISNSCSPGDPLVLERPPPR 89 >SB_21994| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 159 Score = 39.5 bits (88), Expect = 0.001 Identities = 16/20 (80%), Positives = 17/20 (85%) Frame = -3 Query: 89 LVPNSCSPGDPLVLEXPPGR 30 L+ NSCSPGDPLVLE PP R Sbjct: 34 LISNSCSPGDPLVLERPPPR 53 >SB_17082| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 146 Score = 39.5 bits (88), Expect = 0.001 Identities = 16/20 (80%), Positives = 17/20 (85%) Frame = -3 Query: 89 LVPNSCSPGDPLVLEXPPGR 30 L+ NSCSPGDPLVLE PP R Sbjct: 21 LISNSCSPGDPLVLERPPPR 40 >SB_12793| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 39.5 bits (88), Expect = 0.001 Identities = 16/20 (80%), Positives = 17/20 (85%) Frame = -3 Query: 89 LVPNSCSPGDPLVLEXPPGR 30 L+ NSCSPGDPLVLE PP R Sbjct: 16 LISNSCSPGDPLVLERPPPR 35 >SB_9035| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 160 Score = 39.5 bits (88), Expect = 0.001 Identities = 16/21 (76%), Positives = 17/21 (80%) Frame = -3 Query: 92 GLVPNSCSPGDPLVLEXPPGR 30 G + NSCSPGDPLVLE PP R Sbjct: 34 GFLSNSCSPGDPLVLERPPPR 54 >SB_8174| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 39.5 bits (88), Expect = 0.001 Identities = 16/20 (80%), Positives = 17/20 (85%) Frame = -3 Query: 89 LVPNSCSPGDPLVLEXPPGR 30 L+ NSCSPGDPLVLE PP R Sbjct: 33 LISNSCSPGDPLVLERPPPR 52 >SB_4857| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 39.5 bits (88), Expect = 0.001 Identities = 17/21 (80%), Positives = 17/21 (80%) Frame = -3 Query: 92 GLVPNSCSPGDPLVLEXPPGR 30 GL NSCSPGDPLVLE PP R Sbjct: 3 GLRSNSCSPGDPLVLERPPPR 23 >SB_4560| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 39.5 bits (88), Expect = 0.001 Identities = 16/20 (80%), Positives = 17/20 (85%) Frame = -3 Query: 89 LVPNSCSPGDPLVLEXPPGR 30 L+ NSCSPGDPLVLE PP R Sbjct: 31 LISNSCSPGDPLVLERPPPR 50 >SB_13544| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 139 Score = 39.1 bits (87), Expect = 0.002 Identities = 16/22 (72%), Positives = 18/22 (81%) Frame = -3 Query: 95 NGLVPNSCSPGDPLVLEXPPGR 30 N ++ NSCSPGDPLVLE PP R Sbjct: 12 NIVISNSCSPGDPLVLERPPPR 33 >SB_3677| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 39.1 bits (87), Expect = 0.002 Identities = 17/22 (77%), Positives = 17/22 (77%) Frame = -3 Query: 95 NGLVPNSCSPGDPLVLEXPPGR 30 N L NSCSPGDPLVLE PP R Sbjct: 3 NLLASNSCSPGDPLVLERPPPR 24 >SB_55041| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 171 Score = 39.1 bits (87), Expect = 0.002 Identities = 16/22 (72%), Positives = 17/22 (77%) Frame = -3 Query: 95 NGLVPNSCSPGDPLVLEXPPGR 30 N + NSCSPGDPLVLE PP R Sbjct: 44 NFFISNSCSPGDPLVLERPPPR 65 >SB_45525| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 39.1 bits (87), Expect = 0.002 Identities = 16/20 (80%), Positives = 17/20 (85%) Frame = -3 Query: 89 LVPNSCSPGDPLVLEXPPGR 30 +V NSCSPGDPLVLE PP R Sbjct: 11 MVSNSCSPGDPLVLERPPPR 30 >SB_41071| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 39.1 bits (87), Expect = 0.002 Identities = 16/20 (80%), Positives = 17/20 (85%) Frame = -3 Query: 89 LVPNSCSPGDPLVLEXPPGR 30 +V NSCSPGDPLVLE PP R Sbjct: 1 MVSNSCSPGDPLVLERPPPR 20 >SB_23012| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 210 Score = 39.1 bits (87), Expect = 0.002 Identities = 16/20 (80%), Positives = 17/20 (85%) Frame = -3 Query: 89 LVPNSCSPGDPLVLEXPPGR 30 +V NSCSPGDPLVLE PP R Sbjct: 85 IVSNSCSPGDPLVLERPPPR 104 >SB_19004| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 39.1 bits (87), Expect = 0.002 Identities = 16/20 (80%), Positives = 17/20 (85%) Frame = -3 Query: 89 LVPNSCSPGDPLVLEXPPGR 30 +V NSCSPGDPLVLE PP R Sbjct: 13 IVSNSCSPGDPLVLERPPPR 32 >SB_12358| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 39.1 bits (87), Expect = 0.002 Identities = 16/20 (80%), Positives = 17/20 (85%) Frame = -3 Query: 89 LVPNSCSPGDPLVLEXPPGR 30 +V NSCSPGDPLVLE PP R Sbjct: 1 MVSNSCSPGDPLVLERPPPR 20 >SB_9177| Best HMM Match : PPI_Ypi1 (HMM E-Value=1.9) Length = 121 Score = 39.1 bits (87), Expect = 0.002 Identities = 16/21 (76%), Positives = 17/21 (80%) Frame = -3 Query: 92 GLVPNSCSPGDPLVLEXPPGR 30 G+ NSCSPGDPLVLE PP R Sbjct: 93 GISSNSCSPGDPLVLERPPPR 113 >SB_7956| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 39.1 bits (87), Expect = 0.002 Identities = 16/21 (76%), Positives = 16/21 (76%) Frame = -3 Query: 92 GLVPNSCSPGDPLVLEXPPGR 30 G NSCSPGDPLVLE PP R Sbjct: 6 GFTSNSCSPGDPLVLERPPPR 26 >SB_5582| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 150 Score = 39.1 bits (87), Expect = 0.002 Identities = 16/22 (72%), Positives = 18/22 (81%) Frame = -3 Query: 95 NGLVPNSCSPGDPLVLEXPPGR 30 N ++ NSCSPGDPLVLE PP R Sbjct: 23 NIVISNSCSPGDPLVLERPPPR 44 >SB_49285| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 38.7 bits (86), Expect = 0.002 Identities = 15/20 (75%), Positives = 17/20 (85%) Frame = -3 Query: 89 LVPNSCSPGDPLVLEXPPGR 30 ++ NSCSPGDPLVLE PP R Sbjct: 17 IISNSCSPGDPLVLERPPPR 36 >SB_46691| Best HMM Match : DUF765 (HMM E-Value=9.5) Length = 139 Score = 38.7 bits (86), Expect = 0.002 Identities = 17/26 (65%), Positives = 19/26 (73%) Frame = -3 Query: 107 KDR*NGLVPNSCSPGDPLVLEXPPGR 30 ++R V NSCSPGDPLVLE PP R Sbjct: 8 RERSASQVSNSCSPGDPLVLERPPPR 33 >SB_41066| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 186 Score = 38.7 bits (86), Expect = 0.002 Identities = 16/20 (80%), Positives = 17/20 (85%) Frame = -3 Query: 89 LVPNSCSPGDPLVLEXPPGR 30 L+ NSCSPGDPLVLE PP R Sbjct: 62 LLSNSCSPGDPLVLERPPPR 81 >SB_38948| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 137 Score = 38.7 bits (86), Expect = 0.002 Identities = 16/22 (72%), Positives = 16/22 (72%) Frame = -3 Query: 95 NGLVPNSCSPGDPLVLEXPPGR 30 N NSCSPGDPLVLE PP R Sbjct: 11 NSTASNSCSPGDPLVLERPPPR 32 >SB_33475| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 38.7 bits (86), Expect = 0.002 Identities = 16/21 (76%), Positives = 17/21 (80%) Frame = -3 Query: 92 GLVPNSCSPGDPLVLEXPPGR 30 G + NSCSPGDPLVLE PP R Sbjct: 19 GGISNSCSPGDPLVLERPPPR 39 >SB_30432| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 346 Score = 38.7 bits (86), Expect = 0.002 Identities = 15/20 (75%), Positives = 17/20 (85%) Frame = -3 Query: 89 LVPNSCSPGDPLVLEXPPGR 30 ++ NSCSPGDPLVLE PP R Sbjct: 119 IISNSCSPGDPLVLERPPPR 138 >SB_1988| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 3889 Score = 38.7 bits (86), Expect = 0.002 Identities = 16/20 (80%), Positives = 17/20 (85%) Frame = -3 Query: 89 LVPNSCSPGDPLVLEXPPGR 30 +V NSCSPGDPLVLE PP R Sbjct: 3474 VVSNSCSPGDPLVLERPPPR 3493 >SB_1420| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 38.7 bits (86), Expect = 0.002 Identities = 16/22 (72%), Positives = 17/22 (77%) Frame = -3 Query: 95 NGLVPNSCSPGDPLVLEXPPGR 30 +G NSCSPGDPLVLE PP R Sbjct: 11 SGKASNSCSPGDPLVLERPPPR 32 >SB_50748| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 38.7 bits (86), Expect = 0.002 Identities = 15/20 (75%), Positives = 17/20 (85%) Frame = -3 Query: 89 LVPNSCSPGDPLVLEXPPGR 30 ++ NSCSPGDPLVLE PP R Sbjct: 13 IISNSCSPGDPLVLERPPPR 32 >SB_50652| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 38.7 bits (86), Expect = 0.002 Identities = 16/20 (80%), Positives = 17/20 (85%) Frame = -3 Query: 89 LVPNSCSPGDPLVLEXPPGR 30 +V NSCSPGDPLVLE PP R Sbjct: 7 VVSNSCSPGDPLVLERPPPR 26 >SB_50465| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 179 Score = 38.7 bits (86), Expect = 0.002 Identities = 16/20 (80%), Positives = 17/20 (85%) Frame = -3 Query: 89 LVPNSCSPGDPLVLEXPPGR 30 L+ NSCSPGDPLVLE PP R Sbjct: 54 LLSNSCSPGDPLVLERPPPR 73 >SB_47807| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 38.7 bits (86), Expect = 0.002 Identities = 16/20 (80%), Positives = 17/20 (85%) Frame = -3 Query: 89 LVPNSCSPGDPLVLEXPPGR 30 L+ NSCSPGDPLVLE PP R Sbjct: 2 LLSNSCSPGDPLVLERPPPR 21 >SB_47618| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 103 Score = 38.7 bits (86), Expect = 0.002 Identities = 16/22 (72%), Positives = 17/22 (77%) Frame = -3 Query: 95 NGLVPNSCSPGDPLVLEXPPGR 30 N + NSCSPGDPLVLE PP R Sbjct: 4 NSQLSNSCSPGDPLVLERPPPR 25 >SB_44913| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 38.7 bits (86), Expect = 0.002 Identities = 16/20 (80%), Positives = 17/20 (85%) Frame = -3 Query: 89 LVPNSCSPGDPLVLEXPPGR 30 L+ NSCSPGDPLVLE PP R Sbjct: 6 LLSNSCSPGDPLVLERPPPR 25 >SB_39514| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 38.7 bits (86), Expect = 0.002 Identities = 16/20 (80%), Positives = 17/20 (85%) Frame = -3 Query: 89 LVPNSCSPGDPLVLEXPPGR 30 +V NSCSPGDPLVLE PP R Sbjct: 19 VVSNSCSPGDPLVLERPPPR 38 >SB_38641| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 38.7 bits (86), Expect = 0.002 Identities = 15/20 (75%), Positives = 17/20 (85%) Frame = -3 Query: 89 LVPNSCSPGDPLVLEXPPGR 30 ++ NSCSPGDPLVLE PP R Sbjct: 5 IISNSCSPGDPLVLERPPPR 24 >SB_36087| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 137 Score = 38.7 bits (86), Expect = 0.002 Identities = 17/25 (68%), Positives = 19/25 (76%) Frame = -3 Query: 104 DR*NGLVPNSCSPGDPLVLEXPPGR 30 DR + + NSCSPGDPLVLE PP R Sbjct: 7 DRESYALSNSCSPGDPLVLERPPPR 31 >SB_33697| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 38.7 bits (86), Expect = 0.002 Identities = 15/22 (68%), Positives = 18/22 (81%) Frame = -3 Query: 95 NGLVPNSCSPGDPLVLEXPPGR 30 + ++ NSCSPGDPLVLE PP R Sbjct: 3 HNVISNSCSPGDPLVLERPPPR 24 >SB_22981| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 38.7 bits (86), Expect = 0.002 Identities = 15/20 (75%), Positives = 17/20 (85%) Frame = -3 Query: 89 LVPNSCSPGDPLVLEXPPGR 30 ++ NSCSPGDPLVLE PP R Sbjct: 1 MISNSCSPGDPLVLERPPPR 20 >SB_16374| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 38.7 bits (86), Expect = 0.002 Identities = 16/20 (80%), Positives = 17/20 (85%) Frame = -3 Query: 89 LVPNSCSPGDPLVLEXPPGR 30 L+ NSCSPGDPLVLE PP R Sbjct: 1 LLSNSCSPGDPLVLERPPPR 20 >SB_15205| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 38.7 bits (86), Expect = 0.002 Identities = 15/20 (75%), Positives = 17/20 (85%) Frame = -3 Query: 89 LVPNSCSPGDPLVLEXPPGR 30 ++ NSCSPGDPLVLE PP R Sbjct: 4 IISNSCSPGDPLVLERPPPR 23 >SB_14826| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 38.7 bits (86), Expect = 0.002 Identities = 18/21 (85%), Positives = 18/21 (85%), Gaps = 1/21 (4%) Frame = -3 Query: 89 LVP-NSCSPGDPLVLEXPPGR 30 LVP NSCSPGDPLVLE PP R Sbjct: 27 LVPSNSCSPGDPLVLERPPPR 47 >SB_13552| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 38.7 bits (86), Expect = 0.002 Identities = 16/20 (80%), Positives = 17/20 (85%) Frame = -3 Query: 89 LVPNSCSPGDPLVLEXPPGR 30 L+ NSCSPGDPLVLE PP R Sbjct: 7 LLSNSCSPGDPLVLERPPPR 26 >SB_9210| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 152 Score = 38.7 bits (86), Expect = 0.002 Identities = 16/20 (80%), Positives = 17/20 (85%) Frame = -3 Query: 89 LVPNSCSPGDPLVLEXPPGR 30 +V NSCSPGDPLVLE PP R Sbjct: 27 VVSNSCSPGDPLVLERPPPR 46 >SB_7598| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 38.7 bits (86), Expect = 0.002 Identities = 15/20 (75%), Positives = 17/20 (85%) Frame = -3 Query: 89 LVPNSCSPGDPLVLEXPPGR 30 ++ NSCSPGDPLVLE PP R Sbjct: 13 IISNSCSPGDPLVLERPPPR 32 >SB_6726| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 38.7 bits (86), Expect = 0.002 Identities = 17/25 (68%), Positives = 18/25 (72%) Frame = -3 Query: 104 DR*NGLVPNSCSPGDPLVLEXPPGR 30 D+ V NSCSPGDPLVLE PP R Sbjct: 11 DKIADFVSNSCSPGDPLVLERPPPR 35 >SB_5856| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 151 Score = 38.7 bits (86), Expect = 0.002 Identities = 15/20 (75%), Positives = 17/20 (85%) Frame = -3 Query: 89 LVPNSCSPGDPLVLEXPPGR 30 ++ NSCSPGDPLVLE PP R Sbjct: 26 IISNSCSPGDPLVLERPPPR 45 >SB_1971| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 38.7 bits (86), Expect = 0.002 Identities = 16/21 (76%), Positives = 17/21 (80%) Frame = -3 Query: 92 GLVPNSCSPGDPLVLEXPPGR 30 G+ NSCSPGDPLVLE PP R Sbjct: 10 GVSSNSCSPGDPLVLERPPPR 30 >SB_56744| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 154 Score = 38.3 bits (85), Expect = 0.003 Identities = 16/19 (84%), Positives = 16/19 (84%) Frame = -3 Query: 86 VPNSCSPGDPLVLEXPPGR 30 V NSCSPGDPLVLE PP R Sbjct: 30 VSNSCSPGDPLVLERPPPR 48 >SB_52638| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 38.3 bits (85), Expect = 0.003 Identities = 16/19 (84%), Positives = 16/19 (84%) Frame = -3 Query: 86 VPNSCSPGDPLVLEXPPGR 30 V NSCSPGDPLVLE PP R Sbjct: 7 VSNSCSPGDPLVLERPPPR 25 >SB_49418| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 38.3 bits (85), Expect = 0.003 Identities = 16/19 (84%), Positives = 16/19 (84%) Frame = -3 Query: 86 VPNSCSPGDPLVLEXPPGR 30 V NSCSPGDPLVLE PP R Sbjct: 10 VSNSCSPGDPLVLERPPPR 28 >SB_44516| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 137 Score = 38.3 bits (85), Expect = 0.003 Identities = 16/22 (72%), Positives = 17/22 (77%) Frame = -3 Query: 95 NGLVPNSCSPGDPLVLEXPPGR 30 N + NSCSPGDPLVLE PP R Sbjct: 10 NAVRSNSCSPGDPLVLERPPPR 31 >SB_39503| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 38.3 bits (85), Expect = 0.003 Identities = 16/19 (84%), Positives = 16/19 (84%) Frame = -3 Query: 86 VPNSCSPGDPLVLEXPPGR 30 V NSCSPGDPLVLE PP R Sbjct: 2 VSNSCSPGDPLVLERPPPR 20 >SB_30594| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 38.3 bits (85), Expect = 0.003 Identities = 16/20 (80%), Positives = 16/20 (80%) Frame = -3 Query: 89 LVPNSCSPGDPLVLEXPPGR 30 L NSCSPGDPLVLE PP R Sbjct: 15 LTSNSCSPGDPLVLERPPPR 34 >SB_25680| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 38.3 bits (85), Expect = 0.003 Identities = 16/21 (76%), Positives = 16/21 (76%) Frame = -3 Query: 92 GLVPNSCSPGDPLVLEXPPGR 30 G NSCSPGDPLVLE PP R Sbjct: 14 GKTSNSCSPGDPLVLERPPPR 34 >SB_22621| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 164 Score = 38.3 bits (85), Expect = 0.003 Identities = 16/19 (84%), Positives = 16/19 (84%) Frame = -3 Query: 86 VPNSCSPGDPLVLEXPPGR 30 V NSCSPGDPLVLE PP R Sbjct: 40 VSNSCSPGDPLVLERPPPR 58 >SB_21689| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 241 Score = 38.3 bits (85), Expect = 0.003 Identities = 16/19 (84%), Positives = 16/19 (84%) Frame = -3 Query: 86 VPNSCSPGDPLVLEXPPGR 30 V NSCSPGDPLVLE PP R Sbjct: 117 VSNSCSPGDPLVLERPPPR 135 >SB_21022| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 308 Score = 38.3 bits (85), Expect = 0.003 Identities = 16/19 (84%), Positives = 16/19 (84%) Frame = -3 Query: 86 VPNSCSPGDPLVLEXPPGR 30 V NSCSPGDPLVLE PP R Sbjct: 184 VSNSCSPGDPLVLERPPPR 202 >SB_19244| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 38.3 bits (85), Expect = 0.003 Identities = 16/19 (84%), Positives = 16/19 (84%) Frame = -3 Query: 86 VPNSCSPGDPLVLEXPPGR 30 V NSCSPGDPLVLE PP R Sbjct: 34 VSNSCSPGDPLVLERPPPR 52 >SB_16794| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1407 Score = 38.3 bits (85), Expect = 0.003 Identities = 16/19 (84%), Positives = 16/19 (84%) Frame = -3 Query: 86 VPNSCSPGDPLVLEXPPGR 30 V NSCSPGDPLVLE PP R Sbjct: 1066 VSNSCSPGDPLVLERPPPR 1084 >SB_12111| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 447 Score = 38.3 bits (85), Expect = 0.003 Identities = 16/20 (80%), Positives = 16/20 (80%) Frame = -3 Query: 89 LVPNSCSPGDPLVLEXPPGR 30 L NSCSPGDPLVLE PP R Sbjct: 78 LTSNSCSPGDPLVLERPPPR 97 >SB_8996| Best HMM Match : DUF765 (HMM E-Value=7.2) Length = 190 Score = 38.3 bits (85), Expect = 0.003 Identities = 17/26 (65%), Positives = 18/26 (69%) Frame = -3 Query: 107 KDR*NGLVPNSCSPGDPLVLEXPPGR 30 K R + NSCSPGDPLVLE PP R Sbjct: 59 KRRKSSTTSNSCSPGDPLVLERPPPR 84 >SB_8988| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 38.3 bits (85), Expect = 0.003 Identities = 16/19 (84%), Positives = 16/19 (84%) Frame = -3 Query: 86 VPNSCSPGDPLVLEXPPGR 30 V NSCSPGDPLVLE PP R Sbjct: 3 VSNSCSPGDPLVLERPPPR 21 >SB_8663| Best HMM Match : DUF250 (HMM E-Value=9.3e-05) Length = 680 Score = 38.3 bits (85), Expect = 0.003 Identities = 16/19 (84%), Positives = 16/19 (84%) Frame = -3 Query: 86 VPNSCSPGDPLVLEXPPGR 30 V NSCSPGDPLVLE PP R Sbjct: 214 VSNSCSPGDPLVLERPPPR 232 >SB_5162| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 38.3 bits (85), Expect = 0.003 Identities = 16/19 (84%), Positives = 16/19 (84%) Frame = -3 Query: 86 VPNSCSPGDPLVLEXPPGR 30 V NSCSPGDPLVLE PP R Sbjct: 32 VSNSCSPGDPLVLERPPPR 50 >SB_57591| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 38.3 bits (85), Expect = 0.003 Identities = 16/19 (84%), Positives = 16/19 (84%) Frame = -3 Query: 86 VPNSCSPGDPLVLEXPPGR 30 V NSCSPGDPLVLE PP R Sbjct: 5 VSNSCSPGDPLVLERPPPR 23 >SB_56961| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 38.3 bits (85), Expect = 0.003 Identities = 16/19 (84%), Positives = 16/19 (84%) Frame = -3 Query: 86 VPNSCSPGDPLVLEXPPGR 30 V NSCSPGDPLVLE PP R Sbjct: 3 VSNSCSPGDPLVLERPPPR 21 >SB_55315| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 38.3 bits (85), Expect = 0.003 Identities = 16/19 (84%), Positives = 16/19 (84%) Frame = -3 Query: 86 VPNSCSPGDPLVLEXPPGR 30 V NSCSPGDPLVLE PP R Sbjct: 7 VSNSCSPGDPLVLERPPPR 25 >SB_54105| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 188 Score = 38.3 bits (85), Expect = 0.003 Identities = 16/19 (84%), Positives = 16/19 (84%) Frame = -3 Query: 86 VPNSCSPGDPLVLEXPPGR 30 V NSCSPGDPLVLE PP R Sbjct: 64 VSNSCSPGDPLVLERPPPR 82 >SB_52710| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 38.3 bits (85), Expect = 0.003 Identities = 16/19 (84%), Positives = 16/19 (84%) Frame = -3 Query: 86 VPNSCSPGDPLVLEXPPGR 30 V NSCSPGDPLVLE PP R Sbjct: 4 VSNSCSPGDPLVLERPPPR 22 >SB_50444| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 38.3 bits (85), Expect = 0.003 Identities = 16/19 (84%), Positives = 16/19 (84%) Frame = -3 Query: 86 VPNSCSPGDPLVLEXPPGR 30 V NSCSPGDPLVLE PP R Sbjct: 19 VSNSCSPGDPLVLERPPPR 37 >SB_49677| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 38.3 bits (85), Expect = 0.003 Identities = 16/19 (84%), Positives = 16/19 (84%) Frame = -3 Query: 86 VPNSCSPGDPLVLEXPPGR 30 V NSCSPGDPLVLE PP R Sbjct: 4 VSNSCSPGDPLVLERPPPR 22 >SB_48334| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 151 Score = 38.3 bits (85), Expect = 0.003 Identities = 16/21 (76%), Positives = 16/21 (76%) Frame = -3 Query: 92 GLVPNSCSPGDPLVLEXPPGR 30 G NSCSPGDPLVLE PP R Sbjct: 25 GKTSNSCSPGDPLVLERPPPR 45 >SB_46485| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 146 Score = 38.3 bits (85), Expect = 0.003 Identities = 16/21 (76%), Positives = 17/21 (80%) Frame = -3 Query: 92 GLVPNSCSPGDPLVLEXPPGR 30 G+ NSCSPGDPLVLE PP R Sbjct: 20 GVGSNSCSPGDPLVLERPPPR 40 >SB_46149| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 38.3 bits (85), Expect = 0.003 Identities = 16/19 (84%), Positives = 16/19 (84%) Frame = -3 Query: 86 VPNSCSPGDPLVLEXPPGR 30 V NSCSPGDPLVLE PP R Sbjct: 25 VSNSCSPGDPLVLERPPPR 43 >SB_45536| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 139 Score = 38.3 bits (85), Expect = 0.003 Identities = 16/19 (84%), Positives = 16/19 (84%) Frame = -3 Query: 86 VPNSCSPGDPLVLEXPPGR 30 V NSCSPGDPLVLE PP R Sbjct: 15 VSNSCSPGDPLVLERPPPR 33 >SB_45377| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 38.3 bits (85), Expect = 0.003 Identities = 16/20 (80%), Positives = 16/20 (80%) Frame = -3 Query: 89 LVPNSCSPGDPLVLEXPPGR 30 L NSCSPGDPLVLE PP R Sbjct: 17 LASNSCSPGDPLVLERPPPR 36 >SB_43133| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 38.3 bits (85), Expect = 0.003 Identities = 16/19 (84%), Positives = 16/19 (84%) Frame = -3 Query: 86 VPNSCSPGDPLVLEXPPGR 30 V NSCSPGDPLVLE PP R Sbjct: 10 VSNSCSPGDPLVLERPPPR 28 >SB_42589| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 183 Score = 38.3 bits (85), Expect = 0.003 Identities = 16/19 (84%), Positives = 16/19 (84%) Frame = -3 Query: 86 VPNSCSPGDPLVLEXPPGR 30 V NSCSPGDPLVLE PP R Sbjct: 59 VSNSCSPGDPLVLERPPPR 77 >SB_40102| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 155 Score = 38.3 bits (85), Expect = 0.003 Identities = 16/19 (84%), Positives = 16/19 (84%) Frame = -3 Query: 86 VPNSCSPGDPLVLEXPPGR 30 V NSCSPGDPLVLE PP R Sbjct: 31 VSNSCSPGDPLVLERPPPR 49 >SB_38659| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 38.3 bits (85), Expect = 0.003 Identities = 16/19 (84%), Positives = 16/19 (84%) Frame = -3 Query: 86 VPNSCSPGDPLVLEXPPGR 30 V NSCSPGDPLVLE PP R Sbjct: 4 VSNSCSPGDPLVLERPPPR 22 >SB_38151| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 165 Score = 38.3 bits (85), Expect = 0.003 Identities = 16/19 (84%), Positives = 16/19 (84%) Frame = -3 Query: 86 VPNSCSPGDPLVLEXPPGR 30 V NSCSPGDPLVLE PP R Sbjct: 41 VSNSCSPGDPLVLERPPPR 59 >SB_37939| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 139 Score = 38.3 bits (85), Expect = 0.003 Identities = 16/19 (84%), Positives = 16/19 (84%) Frame = -3 Query: 86 VPNSCSPGDPLVLEXPPGR 30 V NSCSPGDPLVLE PP R Sbjct: 15 VSNSCSPGDPLVLERPPPR 33 >SB_36967| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 38.3 bits (85), Expect = 0.003 Identities = 16/19 (84%), Positives = 16/19 (84%) Frame = -3 Query: 86 VPNSCSPGDPLVLEXPPGR 30 V NSCSPGDPLVLE PP R Sbjct: 4 VSNSCSPGDPLVLERPPPR 22 >SB_35822| Best HMM Match : DUF765 (HMM E-Value=3.3) Length = 138 Score = 38.3 bits (85), Expect = 0.003 Identities = 16/19 (84%), Positives = 16/19 (84%) Frame = -3 Query: 86 VPNSCSPGDPLVLEXPPGR 30 V NSCSPGDPLVLE PP R Sbjct: 14 VSNSCSPGDPLVLERPPPR 32 >SB_34503| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 38.3 bits (85), Expect = 0.003 Identities = 16/19 (84%), Positives = 16/19 (84%) Frame = -3 Query: 86 VPNSCSPGDPLVLEXPPGR 30 V NSCSPGDPLVLE PP R Sbjct: 6 VSNSCSPGDPLVLERPPPR 24 >SB_32645| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 139 Score = 38.3 bits (85), Expect = 0.003 Identities = 16/19 (84%), Positives = 16/19 (84%) Frame = -3 Query: 86 VPNSCSPGDPLVLEXPPGR 30 V NSCSPGDPLVLE PP R Sbjct: 15 VSNSCSPGDPLVLERPPPR 33 >SB_32565| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 162 Score = 38.3 bits (85), Expect = 0.003 Identities = 16/20 (80%), Positives = 16/20 (80%) Frame = -3 Query: 89 LVPNSCSPGDPLVLEXPPGR 30 L NSCSPGDPLVLE PP R Sbjct: 37 LTSNSCSPGDPLVLERPPPR 56 >SB_30829| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 38.3 bits (85), Expect = 0.003 Identities = 16/19 (84%), Positives = 16/19 (84%) Frame = -3 Query: 86 VPNSCSPGDPLVLEXPPGR 30 V NSCSPGDPLVLE PP R Sbjct: 18 VSNSCSPGDPLVLERPPPR 36 >SB_30632| Best HMM Match : Acyltransferase (HMM E-Value=0.0097) Length = 263 Score = 38.3 bits (85), Expect = 0.003 Identities = 16/21 (76%), Positives = 17/21 (80%) Frame = -3 Query: 92 GLVPNSCSPGDPLVLEXPPGR 30 G + NSCSPGDPLVLE PP R Sbjct: 13 GELSNSCSPGDPLVLERPPPR 33 >SB_30574| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 399 Score = 38.3 bits (85), Expect = 0.003 Identities = 16/20 (80%), Positives = 16/20 (80%) Frame = -3 Query: 89 LVPNSCSPGDPLVLEXPPGR 30 L NSCSPGDPLVLE PP R Sbjct: 20 LASNSCSPGDPLVLERPPPR 39 >SB_29978| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 38.3 bits (85), Expect = 0.003 Identities = 16/20 (80%), Positives = 16/20 (80%) Frame = -3 Query: 89 LVPNSCSPGDPLVLEXPPGR 30 L NSCSPGDPLVLE PP R Sbjct: 11 LTSNSCSPGDPLVLERPPPR 30 >SB_28515| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 154 Score = 38.3 bits (85), Expect = 0.003 Identities = 16/19 (84%), Positives = 16/19 (84%) Frame = -3 Query: 86 VPNSCSPGDPLVLEXPPGR 30 V NSCSPGDPLVLE PP R Sbjct: 30 VSNSCSPGDPLVLERPPPR 48 >SB_26694| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 38.3 bits (85), Expect = 0.003 Identities = 17/22 (77%), Positives = 18/22 (81%) Frame = -3 Query: 95 NGLVPNSCSPGDPLVLEXPPGR 30 NG + NSCSPGDPLVLE PP R Sbjct: 6 NG-ISNSCSPGDPLVLERPPPR 26 >SB_25053| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 38.3 bits (85), Expect = 0.003 Identities = 16/19 (84%), Positives = 16/19 (84%) Frame = -3 Query: 86 VPNSCSPGDPLVLEXPPGR 30 V NSCSPGDPLVLE PP R Sbjct: 32 VSNSCSPGDPLVLERPPPR 50 >SB_23700| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 38.3 bits (85), Expect = 0.003 Identities = 16/19 (84%), Positives = 16/19 (84%) Frame = -3 Query: 86 VPNSCSPGDPLVLEXPPGR 30 V NSCSPGDPLVLE PP R Sbjct: 10 VSNSCSPGDPLVLERPPPR 28 >SB_21779| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 38.3 bits (85), Expect = 0.003 Identities = 16/19 (84%), Positives = 16/19 (84%) Frame = -3 Query: 86 VPNSCSPGDPLVLEXPPGR 30 V NSCSPGDPLVLE PP R Sbjct: 17 VSNSCSPGDPLVLERPPPR 35 >SB_21702| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 38.3 bits (85), Expect = 0.003 Identities = 16/19 (84%), Positives = 16/19 (84%) Frame = -3 Query: 86 VPNSCSPGDPLVLEXPPGR 30 V NSCSPGDPLVLE PP R Sbjct: 14 VSNSCSPGDPLVLERPPPR 32 >SB_21233| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 38.3 bits (85), Expect = 0.003 Identities = 16/19 (84%), Positives = 16/19 (84%) Frame = -3 Query: 86 VPNSCSPGDPLVLEXPPGR 30 V NSCSPGDPLVLE PP R Sbjct: 34 VSNSCSPGDPLVLERPPPR 52 >SB_19926| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 213 Score = 38.3 bits (85), Expect = 0.003 Identities = 16/20 (80%), Positives = 16/20 (80%) Frame = -3 Query: 89 LVPNSCSPGDPLVLEXPPGR 30 L NSCSPGDPLVLE PP R Sbjct: 88 LTSNSCSPGDPLVLERPPPR 107 >SB_19315| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 38.3 bits (85), Expect = 0.003 Identities = 16/20 (80%), Positives = 16/20 (80%) Frame = -3 Query: 89 LVPNSCSPGDPLVLEXPPGR 30 L NSCSPGDPLVLE PP R Sbjct: 11 LASNSCSPGDPLVLERPPPR 30 >SB_19181| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 38.3 bits (85), Expect = 0.003 Identities = 15/20 (75%), Positives = 17/20 (85%) Frame = -3 Query: 89 LVPNSCSPGDPLVLEXPPGR 30 ++ NSCSPGDPLVLE PP R Sbjct: 17 VISNSCSPGDPLVLERPPPR 36 >SB_16330| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 38.3 bits (85), Expect = 0.003 Identities = 16/19 (84%), Positives = 16/19 (84%) Frame = -3 Query: 86 VPNSCSPGDPLVLEXPPGR 30 V NSCSPGDPLVLE PP R Sbjct: 8 VSNSCSPGDPLVLERPPPR 26 >SB_14766| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 38.3 bits (85), Expect = 0.003 Identities = 16/19 (84%), Positives = 16/19 (84%) Frame = -3 Query: 86 VPNSCSPGDPLVLEXPPGR 30 V NSCSPGDPLVLE PP R Sbjct: 10 VSNSCSPGDPLVLERPPPR 28 >SB_14383| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 147 Score = 38.3 bits (85), Expect = 0.003 Identities = 16/19 (84%), Positives = 16/19 (84%) Frame = -3 Query: 86 VPNSCSPGDPLVLEXPPGR 30 V NSCSPGDPLVLE PP R Sbjct: 23 VSNSCSPGDPLVLERPPPR 41 >SB_13084| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 38.3 bits (85), Expect = 0.003 Identities = 16/20 (80%), Positives = 16/20 (80%) Frame = -3 Query: 89 LVPNSCSPGDPLVLEXPPGR 30 L NSCSPGDPLVLE PP R Sbjct: 11 LASNSCSPGDPLVLERPPPR 30 >SB_12674| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 38.3 bits (85), Expect = 0.003 Identities = 16/20 (80%), Positives = 16/20 (80%) Frame = -3 Query: 89 LVPNSCSPGDPLVLEXPPGR 30 L NSCSPGDPLVLE PP R Sbjct: 3 LASNSCSPGDPLVLERPPPR 22 >SB_12453| Best HMM Match : DUF765 (HMM E-Value=5) Length = 140 Score = 38.3 bits (85), Expect = 0.003 Identities = 16/20 (80%), Positives = 16/20 (80%) Frame = -3 Query: 89 LVPNSCSPGDPLVLEXPPGR 30 L NSCSPGDPLVLE PP R Sbjct: 15 LTSNSCSPGDPLVLERPPPR 34 >SB_9975| Best HMM Match : 7tm_2 (HMM E-Value=1.9e-38) Length = 1101 Score = 38.3 bits (85), Expect = 0.003 Identities = 16/20 (80%), Positives = 16/20 (80%) Frame = -3 Query: 89 LVPNSCSPGDPLVLEXPPGR 30 L NSCSPGDPLVLE PP R Sbjct: 661 LASNSCSPGDPLVLERPPPR 680 >SB_9111| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 151 Score = 38.3 bits (85), Expect = 0.003 Identities = 16/19 (84%), Positives = 16/19 (84%) Frame = -3 Query: 86 VPNSCSPGDPLVLEXPPGR 30 V NSCSPGDPLVLE PP R Sbjct: 27 VSNSCSPGDPLVLERPPPR 45 >SB_9069| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 38.3 bits (85), Expect = 0.003 Identities = 16/20 (80%), Positives = 16/20 (80%) Frame = -3 Query: 89 LVPNSCSPGDPLVLEXPPGR 30 L NSCSPGDPLVLE PP R Sbjct: 7 LASNSCSPGDPLVLERPPPR 26 >SB_8550| Best HMM Match : MASE1 (HMM E-Value=1.5) Length = 317 Score = 38.3 bits (85), Expect = 0.003 Identities = 16/19 (84%), Positives = 16/19 (84%) Frame = -3 Query: 86 VPNSCSPGDPLVLEXPPGR 30 V NSCSPGDPLVLE PP R Sbjct: 193 VSNSCSPGDPLVLERPPPR 211 >SB_7969| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 157 Score = 38.3 bits (85), Expect = 0.003 Identities = 16/22 (72%), Positives = 17/22 (77%) Frame = -3 Query: 95 NGLVPNSCSPGDPLVLEXPPGR 30 N + NSCSPGDPLVLE PP R Sbjct: 30 NKALSNSCSPGDPLVLERPPPR 51 >SB_6839| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 38.3 bits (85), Expect = 0.003 Identities = 16/19 (84%), Positives = 16/19 (84%) Frame = -3 Query: 86 VPNSCSPGDPLVLEXPPGR 30 V NSCSPGDPLVLE PP R Sbjct: 9 VSNSCSPGDPLVLERPPPR 27 >SB_3006| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 38.3 bits (85), Expect = 0.003 Identities = 17/24 (70%), Positives = 19/24 (79%), Gaps = 3/24 (12%) Frame = -3 Query: 92 GLVP---NSCSPGDPLVLEXPPGR 30 G++P NSCSPGDPLVLE PP R Sbjct: 9 GIIPKPSNSCSPGDPLVLERPPPR 32 >SB_2671| Best HMM Match : Amidohydro_2 (HMM E-Value=5.6) Length = 270 Score = 38.3 bits (85), Expect = 0.003 Identities = 16/22 (72%), Positives = 17/22 (77%) Frame = -3 Query: 95 NGLVPNSCSPGDPLVLEXPPGR 30 N + NSCSPGDPLVLE PP R Sbjct: 143 NLITSNSCSPGDPLVLERPPPR 164 >SB_2190| Best HMM Match : SGS (HMM E-Value=2.5) Length = 221 Score = 38.3 bits (85), Expect = 0.003 Identities = 16/20 (80%), Positives = 16/20 (80%) Frame = -3 Query: 89 LVPNSCSPGDPLVLEXPPGR 30 L NSCSPGDPLVLE PP R Sbjct: 96 LASNSCSPGDPLVLERPPPR 115 >SB_1535| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 38.3 bits (85), Expect = 0.003 Identities = 16/20 (80%), Positives = 16/20 (80%) Frame = -3 Query: 89 LVPNSCSPGDPLVLEXPPGR 30 L NSCSPGDPLVLE PP R Sbjct: 4 LASNSCSPGDPLVLERPPPR 23 >SB_516| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 38.3 bits (85), Expect = 0.003 Identities = 16/19 (84%), Positives = 16/19 (84%) Frame = -3 Query: 86 VPNSCSPGDPLVLEXPPGR 30 V NSCSPGDPLVLE PP R Sbjct: 10 VSNSCSPGDPLVLERPPPR 28 >SB_56764| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 225 Score = 37.9 bits (84), Expect = 0.004 Identities = 15/19 (78%), Positives = 16/19 (84%) Frame = -3 Query: 86 VPNSCSPGDPLVLEXPPGR 30 + NSCSPGDPLVLE PP R Sbjct: 101 ISNSCSPGDPLVLERPPPR 119 >SB_56737| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 37.9 bits (84), Expect = 0.004 Identities = 16/22 (72%), Positives = 17/22 (77%) Frame = -3 Query: 95 NGLVPNSCSPGDPLVLEXPPGR 30 +G NSCSPGDPLVLE PP R Sbjct: 3 DGGASNSCSPGDPLVLERPPPR 24 >SB_54029| Best HMM Match : DUF765 (HMM E-Value=6.6) Length = 137 Score = 37.9 bits (84), Expect = 0.004 Identities = 16/22 (72%), Positives = 16/22 (72%) Frame = -3 Query: 95 NGLVPNSCSPGDPLVLEXPPGR 30 N NSCSPGDPLVLE PP R Sbjct: 10 NSHTSNSCSPGDPLVLERPPPR 31 >SB_50722| Best HMM Match : Cullin (HMM E-Value=1.2e-20) Length = 385 Score = 37.9 bits (84), Expect = 0.004 Identities = 15/19 (78%), Positives = 16/19 (84%) Frame = -3 Query: 86 VPNSCSPGDPLVLEXPPGR 30 + NSCSPGDPLVLE PP R Sbjct: 261 ISNSCSPGDPLVLERPPPR 279 >SB_48217| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 37.9 bits (84), Expect = 0.004 Identities = 15/19 (78%), Positives = 16/19 (84%) Frame = -3 Query: 86 VPNSCSPGDPLVLEXPPGR 30 + NSCSPGDPLVLE PP R Sbjct: 16 ISNSCSPGDPLVLERPPPR 34 >SB_40614| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 162 Score = 37.9 bits (84), Expect = 0.004 Identities = 15/22 (68%), Positives = 17/22 (77%) Frame = -3 Query: 95 NGLVPNSCSPGDPLVLEXPPGR 30 + + NSCSPGDPLVLE PP R Sbjct: 35 DNIASNSCSPGDPLVLERPPPR 56 >SB_40583| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 37.9 bits (84), Expect = 0.004 Identities = 15/20 (75%), Positives = 17/20 (85%) Frame = -3 Query: 89 LVPNSCSPGDPLVLEXPPGR 30 ++ NSCSPGDPLVLE PP R Sbjct: 13 ILSNSCSPGDPLVLERPPPR 32 >SB_39247| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 37.9 bits (84), Expect = 0.004 Identities = 16/22 (72%), Positives = 17/22 (77%) Frame = -3 Query: 95 NGLVPNSCSPGDPLVLEXPPGR 30 + L NSCSPGDPLVLE PP R Sbjct: 21 DALSSNSCSPGDPLVLERPPPR 42 >SB_25891| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 139 Score = 37.9 bits (84), Expect = 0.004 Identities = 16/22 (72%), Positives = 17/22 (77%) Frame = -3 Query: 95 NGLVPNSCSPGDPLVLEXPPGR 30 N + NSCSPGDPLVLE PP R Sbjct: 12 NIFLSNSCSPGDPLVLERPPPR 33 >SB_25598| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 183 Score = 37.9 bits (84), Expect = 0.004 Identities = 15/19 (78%), Positives = 16/19 (84%) Frame = -3 Query: 86 VPNSCSPGDPLVLEXPPGR 30 + NSCSPGDPLVLE PP R Sbjct: 59 ISNSCSPGDPLVLERPPPR 77 >SB_23442| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 37.9 bits (84), Expect = 0.004 Identities = 15/19 (78%), Positives = 16/19 (84%) Frame = -3 Query: 86 VPNSCSPGDPLVLEXPPGR 30 + NSCSPGDPLVLE PP R Sbjct: 9 ISNSCSPGDPLVLERPPPR 27 >SB_22452| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 37.9 bits (84), Expect = 0.004 Identities = 15/19 (78%), Positives = 16/19 (84%) Frame = -3 Query: 86 VPNSCSPGDPLVLEXPPGR 30 + NSCSPGDPLVLE PP R Sbjct: 10 ISNSCSPGDPLVLERPPPR 28 >SB_20710| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 37.9 bits (84), Expect = 0.004 Identities = 15/19 (78%), Positives = 16/19 (84%) Frame = -3 Query: 86 VPNSCSPGDPLVLEXPPGR 30 + NSCSPGDPLVLE PP R Sbjct: 3 ISNSCSPGDPLVLERPPPR 21 >SB_18012| Best HMM Match : Flavoprotein (HMM E-Value=4.4) Length = 180 Score = 37.9 bits (84), Expect = 0.004 Identities = 15/20 (75%), Positives = 17/20 (85%) Frame = -3 Query: 89 LVPNSCSPGDPLVLEXPPGR 30 ++ NSCSPGDPLVLE PP R Sbjct: 55 ILSNSCSPGDPLVLERPPPR 74 >SB_15611| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 37.9 bits (84), Expect = 0.004 Identities = 15/19 (78%), Positives = 16/19 (84%) Frame = -3 Query: 86 VPNSCSPGDPLVLEXPPGR 30 + NSCSPGDPLVLE PP R Sbjct: 13 ISNSCSPGDPLVLERPPPR 31 >SB_14916| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 37.9 bits (84), Expect = 0.004 Identities = 15/19 (78%), Positives = 16/19 (84%) Frame = -3 Query: 86 VPNSCSPGDPLVLEXPPGR 30 + NSCSPGDPLVLE PP R Sbjct: 4 ISNSCSPGDPLVLERPPPR 22 >SB_13329| Best HMM Match : C1_2 (HMM E-Value=7.3) Length = 176 Score = 37.9 bits (84), Expect = 0.004 Identities = 15/19 (78%), Positives = 16/19 (84%) Frame = -3 Query: 86 VPNSCSPGDPLVLEXPPGR 30 + NSCSPGDPLVLE PP R Sbjct: 52 ISNSCSPGDPLVLERPPPR 70 >SB_13100| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 175 Score = 37.9 bits (84), Expect = 0.004 Identities = 15/19 (78%), Positives = 16/19 (84%) Frame = -3 Query: 86 VPNSCSPGDPLVLEXPPGR 30 + NSCSPGDPLVLE PP R Sbjct: 51 ISNSCSPGDPLVLERPPPR 69 >SB_10491| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 37.9 bits (84), Expect = 0.004 Identities = 15/19 (78%), Positives = 16/19 (84%) Frame = -3 Query: 86 VPNSCSPGDPLVLEXPPGR 30 + NSCSPGDPLVLE PP R Sbjct: 16 ISNSCSPGDPLVLERPPPR 34 >SB_58800| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 37.9 bits (84), Expect = 0.004 Identities = 15/19 (78%), Positives = 16/19 (84%) Frame = -3 Query: 86 VPNSCSPGDPLVLEXPPGR 30 + NSCSPGDPLVLE PP R Sbjct: 21 ISNSCSPGDPLVLERPPPR 39 >SB_58307| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 276 Score = 37.9 bits (84), Expect = 0.004 Identities = 15/19 (78%), Positives = 16/19 (84%) Frame = -3 Query: 86 VPNSCSPGDPLVLEXPPGR 30 + NSCSPGDPLVLE PP R Sbjct: 152 ISNSCSPGDPLVLERPPPR 170 >SB_56302| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 37.9 bits (84), Expect = 0.004 Identities = 15/19 (78%), Positives = 16/19 (84%) Frame = -3 Query: 86 VPNSCSPGDPLVLEXPPGR 30 + NSCSPGDPLVLE PP R Sbjct: 4 ISNSCSPGDPLVLERPPPR 22 >SB_53743| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 37.9 bits (84), Expect = 0.004 Identities = 15/19 (78%), Positives = 16/19 (84%) Frame = -3 Query: 86 VPNSCSPGDPLVLEXPPGR 30 + NSCSPGDPLVLE PP R Sbjct: 7 ISNSCSPGDPLVLERPPPR 25 >SB_53325| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 37.9 bits (84), Expect = 0.004 Identities = 15/19 (78%), Positives = 16/19 (84%) Frame = -3 Query: 86 VPNSCSPGDPLVLEXPPGR 30 + NSCSPGDPLVLE PP R Sbjct: 4 ISNSCSPGDPLVLERPPPR 22 >SB_51146| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 37.9 bits (84), Expect = 0.004 Identities = 15/19 (78%), Positives = 16/19 (84%) Frame = -3 Query: 86 VPNSCSPGDPLVLEXPPGR 30 + NSCSPGDPLVLE PP R Sbjct: 32 ISNSCSPGDPLVLERPPPR 50 >SB_50042| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 37.9 bits (84), Expect = 0.004 Identities = 16/22 (72%), Positives = 17/22 (77%) Frame = -3 Query: 95 NGLVPNSCSPGDPLVLEXPPGR 30 N + NSCSPGDPLVLE PP R Sbjct: 17 NCMKSNSCSPGDPLVLERPPPR 38 >SB_46709| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 176 Score = 37.9 bits (84), Expect = 0.004 Identities = 17/30 (56%), Positives = 19/30 (63%) Frame = +2 Query: 29 TAXXXXLELVDPPGCRNSARAHFTDLYENG 118 TA LELVDPPGCRNS +A D + G Sbjct: 7 TAVAAALELVDPPGCRNSIQARSVDGFAKG 36 >SB_45457| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 37.9 bits (84), Expect = 0.004 Identities = 15/19 (78%), Positives = 16/19 (84%) Frame = -3 Query: 86 VPNSCSPGDPLVLEXPPGR 30 + NSCSPGDPLVLE PP R Sbjct: 18 ISNSCSPGDPLVLERPPPR 36 >SB_45434| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 37.9 bits (84), Expect = 0.004 Identities = 15/19 (78%), Positives = 16/19 (84%) Frame = -3 Query: 86 VPNSCSPGDPLVLEXPPGR 30 + NSCSPGDPLVLE PP R Sbjct: 32 ISNSCSPGDPLVLERPPPR 50 >SB_45157| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2870 Score = 37.9 bits (84), Expect = 0.004 Identities = 15/22 (68%), Positives = 17/22 (77%) Frame = -3 Query: 95 NGLVPNSCSPGDPLVLEXPPGR 30 + + NSCSPGDPLVLE PP R Sbjct: 2419 SAIASNSCSPGDPLVLERPPPR 2440 >SB_43874| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 37.9 bits (84), Expect = 0.004 Identities = 15/19 (78%), Positives = 16/19 (84%) Frame = -3 Query: 86 VPNSCSPGDPLVLEXPPGR 30 + NSCSPGDPLVLE PP R Sbjct: 6 ISNSCSPGDPLVLERPPPR 24 >SB_42996| Best HMM Match : Neur_chan_memb (HMM E-Value=0.14) Length = 190 Score = 37.9 bits (84), Expect = 0.004 Identities = 15/20 (75%), Positives = 17/20 (85%) Frame = -3 Query: 89 LVPNSCSPGDPLVLEXPPGR 30 ++ NSCSPGDPLVLE PP R Sbjct: 65 MLSNSCSPGDPLVLERPPPR 84 >SB_37610| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 37.9 bits (84), Expect = 0.004 Identities = 15/19 (78%), Positives = 16/19 (84%) Frame = -3 Query: 86 VPNSCSPGDPLVLEXPPGR 30 + NSCSPGDPLVLE PP R Sbjct: 1 ISNSCSPGDPLVLERPPPR 19 >SB_37411| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 37.9 bits (84), Expect = 0.004 Identities = 15/19 (78%), Positives = 16/19 (84%) Frame = -3 Query: 86 VPNSCSPGDPLVLEXPPGR 30 + NSCSPGDPLVLE PP R Sbjct: 5 ISNSCSPGDPLVLERPPPR 23 >SB_31700| Best HMM Match : RNA_pol_Rpb1_R (HMM E-Value=6.8) Length = 126 Score = 37.9 bits (84), Expect = 0.004 Identities = 15/19 (78%), Positives = 16/19 (84%) Frame = -3 Query: 86 VPNSCSPGDPLVLEXPPGR 30 + NSCSPGDPLVLE PP R Sbjct: 32 ISNSCSPGDPLVLERPPPR 50 >SB_29275| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 240 Score = 37.9 bits (84), Expect = 0.004 Identities = 15/19 (78%), Positives = 16/19 (84%) Frame = -3 Query: 86 VPNSCSPGDPLVLEXPPGR 30 + NSCSPGDPLVLE PP R Sbjct: 116 ISNSCSPGDPLVLERPPPR 134 >SB_27295| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 37.9 bits (84), Expect = 0.004 Identities = 15/19 (78%), Positives = 16/19 (84%) Frame = -3 Query: 86 VPNSCSPGDPLVLEXPPGR 30 + NSCSPGDPLVLE PP R Sbjct: 2 ISNSCSPGDPLVLERPPPR 20 >SB_27058| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 37.9 bits (84), Expect = 0.004 Identities = 15/19 (78%), Positives = 16/19 (84%) Frame = -3 Query: 86 VPNSCSPGDPLVLEXPPGR 30 + NSCSPGDPLVLE PP R Sbjct: 2 ISNSCSPGDPLVLERPPPR 20 >SB_26956| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 37.9 bits (84), Expect = 0.004 Identities = 15/19 (78%), Positives = 16/19 (84%) Frame = -3 Query: 86 VPNSCSPGDPLVLEXPPGR 30 + NSCSPGDPLVLE PP R Sbjct: 14 ISNSCSPGDPLVLERPPPR 32 >SB_26923| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 37.9 bits (84), Expect = 0.004 Identities = 15/19 (78%), Positives = 16/19 (84%) Frame = -3 Query: 86 VPNSCSPGDPLVLEXPPGR 30 + NSCSPGDPLVLE PP R Sbjct: 2 ISNSCSPGDPLVLERPPPR 20 >SB_17821| Best HMM Match : PQ-loop (HMM E-Value=6.7) Length = 176 Score = 37.9 bits (84), Expect = 0.004 Identities = 15/19 (78%), Positives = 16/19 (84%) Frame = -3 Query: 86 VPNSCSPGDPLVLEXPPGR 30 + NSCSPGDPLVLE PP R Sbjct: 52 ISNSCSPGDPLVLERPPPR 70 >SB_17198| Best HMM Match : HEAT (HMM E-Value=1.8e-15) Length = 802 Score = 37.9 bits (84), Expect = 0.004 Identities = 15/19 (78%), Positives = 16/19 (84%) Frame = -3 Query: 86 VPNSCSPGDPLVLEXPPGR 30 + NSCSPGDPLVLE PP R Sbjct: 90 ISNSCSPGDPLVLERPPPR 108 >SB_17162| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 229 Score = 37.9 bits (84), Expect = 0.004 Identities = 15/20 (75%), Positives = 17/20 (85%) Frame = -3 Query: 89 LVPNSCSPGDPLVLEXPPGR 30 ++ NSCSPGDPLVLE PP R Sbjct: 104 ILSNSCSPGDPLVLERPPPR 123 >SB_13387| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 37.9 bits (84), Expect = 0.004 Identities = 15/19 (78%), Positives = 16/19 (84%) Frame = -3 Query: 86 VPNSCSPGDPLVLEXPPGR 30 + NSCSPGDPLVLE PP R Sbjct: 7 ISNSCSPGDPLVLERPPPR 25 >SB_9854| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 37.9 bits (84), Expect = 0.004 Identities = 16/21 (76%), Positives = 16/21 (76%) Frame = -3 Query: 92 GLVPNSCSPGDPLVLEXPPGR 30 G NSCSPGDPLVLE PP R Sbjct: 17 GPASNSCSPGDPLVLERPPPR 37 >SB_9296| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 137 Score = 37.9 bits (84), Expect = 0.004 Identities = 15/20 (75%), Positives = 17/20 (85%) Frame = -3 Query: 89 LVPNSCSPGDPLVLEXPPGR 30 ++ NSCSPGDPLVLE PP R Sbjct: 12 ILSNSCSPGDPLVLERPPPR 31 >SB_9153| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 111 Score = 37.9 bits (84), Expect = 0.004 Identities = 15/19 (78%), Positives = 16/19 (84%) Frame = -3 Query: 86 VPNSCSPGDPLVLEXPPGR 30 + NSCSPGDPLVLE PP R Sbjct: 6 ISNSCSPGDPLVLERPPPR 24 >SB_8232| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 192 Score = 37.9 bits (84), Expect = 0.004 Identities = 15/19 (78%), Positives = 16/19 (84%) Frame = -3 Query: 86 VPNSCSPGDPLVLEXPPGR 30 + NSCSPGDPLVLE PP R Sbjct: 68 ISNSCSPGDPLVLERPPPR 86 >SB_5754| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 154 Score = 37.9 bits (84), Expect = 0.004 Identities = 15/19 (78%), Positives = 16/19 (84%) Frame = -3 Query: 86 VPNSCSPGDPLVLEXPPGR 30 + NSCSPGDPLVLE PP R Sbjct: 30 ISNSCSPGDPLVLERPPPR 48 >SB_4657| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 170 Score = 37.9 bits (84), Expect = 0.004 Identities = 15/19 (78%), Positives = 16/19 (84%) Frame = -3 Query: 86 VPNSCSPGDPLVLEXPPGR 30 + NSCSPGDPLVLE PP R Sbjct: 46 ISNSCSPGDPLVLERPPPR 64 >SB_4523| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 169 Score = 37.9 bits (84), Expect = 0.004 Identities = 15/19 (78%), Positives = 16/19 (84%) Frame = -3 Query: 86 VPNSCSPGDPLVLEXPPGR 30 + NSCSPGDPLVLE PP R Sbjct: 45 ISNSCSPGDPLVLERPPPR 63 >SB_3515| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1295 Score = 37.9 bits (84), Expect = 0.004 Identities = 15/19 (78%), Positives = 16/19 (84%) Frame = -3 Query: 86 VPNSCSPGDPLVLEXPPGR 30 + NSCSPGDPLVLE PP R Sbjct: 591 ISNSCSPGDPLVLERPPPR 609 >SB_1885| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 37.9 bits (84), Expect = 0.004 Identities = 15/19 (78%), Positives = 16/19 (84%) Frame = -3 Query: 86 VPNSCSPGDPLVLEXPPGR 30 + NSCSPGDPLVLE PP R Sbjct: 4 ISNSCSPGDPLVLERPPPR 22 >SB_1863| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 37.9 bits (84), Expect = 0.004 Identities = 15/19 (78%), Positives = 16/19 (84%) Frame = -3 Query: 86 VPNSCSPGDPLVLEXPPGR 30 + NSCSPGDPLVLE PP R Sbjct: 12 ISNSCSPGDPLVLERPPPR 30 >SB_524| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 37.9 bits (84), Expect = 0.004 Identities = 15/19 (78%), Positives = 16/19 (84%) Frame = -3 Query: 86 VPNSCSPGDPLVLEXPPGR 30 + NSCSPGDPLVLE PP R Sbjct: 10 ISNSCSPGDPLVLERPPPR 28 >SB_454| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 37.9 bits (84), Expect = 0.004 Identities = 15/19 (78%), Positives = 16/19 (84%) Frame = -3 Query: 86 VPNSCSPGDPLVLEXPPGR 30 + NSCSPGDPLVLE PP R Sbjct: 10 ISNSCSPGDPLVLERPPPR 28 >SB_379| Best HMM Match : ADK (HMM E-Value=3.2e-05) Length = 991 Score = 37.9 bits (84), Expect = 0.004 Identities = 16/21 (76%), Positives = 16/21 (76%) Frame = -3 Query: 92 GLVPNSCSPGDPLVLEXPPGR 30 G NSCSPGDPLVLE PP R Sbjct: 534 GNASNSCSPGDPLVLERPPPR 554 >SB_57778| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 37.5 bits (83), Expect = 0.005 Identities = 15/20 (75%), Positives = 16/20 (80%) Frame = -3 Query: 89 LVPNSCSPGDPLVLEXPPGR 30 + NSCSPGDPLVLE PP R Sbjct: 13 IASNSCSPGDPLVLERPPPR 32 >SB_56876| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 150 Score = 37.5 bits (83), Expect = 0.005 Identities = 16/20 (80%), Positives = 16/20 (80%) Frame = -3 Query: 89 LVPNSCSPGDPLVLEXPPGR 30 L NSCSPGDPLVLE PP R Sbjct: 25 LPSNSCSPGDPLVLERPPPR 44 >SB_52366| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 37.5 bits (83), Expect = 0.005 Identities = 15/20 (75%), Positives = 16/20 (80%) Frame = -3 Query: 89 LVPNSCSPGDPLVLEXPPGR 30 + NSCSPGDPLVLE PP R Sbjct: 1 MASNSCSPGDPLVLERPPPR 20 >SB_43510| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 217 Score = 37.5 bits (83), Expect = 0.005 Identities = 15/20 (75%), Positives = 17/20 (85%) Frame = -3 Query: 89 LVPNSCSPGDPLVLEXPPGR 30 ++ NSCSPGDPLVLE PP R Sbjct: 92 VLSNSCSPGDPLVLERPPPR 111 >SB_31351| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 137 Score = 37.5 bits (83), Expect = 0.005 Identities = 15/20 (75%), Positives = 17/20 (85%) Frame = -3 Query: 89 LVPNSCSPGDPLVLEXPPGR 30 ++ NSCSPGDPLVLE PP R Sbjct: 12 VLSNSCSPGDPLVLERPPPR 31 >SB_30600| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 37.5 bits (83), Expect = 0.005 Identities = 15/20 (75%), Positives = 17/20 (85%) Frame = -3 Query: 89 LVPNSCSPGDPLVLEXPPGR 30 ++ NSCSPGDPLVLE PP R Sbjct: 15 VLSNSCSPGDPLVLERPPPR 34 >SB_26393| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 37.5 bits (83), Expect = 0.005 Identities = 15/20 (75%), Positives = 16/20 (80%) Frame = -3 Query: 89 LVPNSCSPGDPLVLEXPPGR 30 + NSCSPGDPLVLE PP R Sbjct: 20 ITSNSCSPGDPLVLERPPPR 39 >SB_25442| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1010 Score = 37.5 bits (83), Expect = 0.005 Identities = 15/20 (75%), Positives = 16/20 (80%) Frame = -3 Query: 89 LVPNSCSPGDPLVLEXPPGR 30 + NSCSPGDPLVLE PP R Sbjct: 82 MASNSCSPGDPLVLERPPPR 101 >SB_19569| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 37.5 bits (83), Expect = 0.005 Identities = 16/20 (80%), Positives = 16/20 (80%) Frame = -3 Query: 89 LVPNSCSPGDPLVLEXPPGR 30 L NSCSPGDPLVLE PP R Sbjct: 7 LPSNSCSPGDPLVLERPPPR 26 >SB_12760| Best HMM Match : DUF765 (HMM E-Value=6.2) Length = 128 Score = 37.5 bits (83), Expect = 0.005 Identities = 16/20 (80%), Positives = 16/20 (80%) Frame = -3 Query: 89 LVPNSCSPGDPLVLEXPPGR 30 L NSCSPGDPLVLE PP R Sbjct: 4 LSSNSCSPGDPLVLERPPPR 23 >SB_8543| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 37.5 bits (83), Expect = 0.005 Identities = 15/20 (75%), Positives = 16/20 (80%) Frame = -3 Query: 89 LVPNSCSPGDPLVLEXPPGR 30 + NSCSPGDPLVLE PP R Sbjct: 18 ITSNSCSPGDPLVLERPPPR 37 >SB_7024| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 159 Score = 37.5 bits (83), Expect = 0.005 Identities = 16/20 (80%), Positives = 16/20 (80%) Frame = -3 Query: 89 LVPNSCSPGDPLVLEXPPGR 30 L NSCSPGDPLVLE PP R Sbjct: 34 LSSNSCSPGDPLVLERPPPR 53 >SB_2138| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 37.5 bits (83), Expect = 0.005 Identities = 15/20 (75%), Positives = 16/20 (80%) Frame = -3 Query: 89 LVPNSCSPGDPLVLEXPPGR 30 + NSCSPGDPLVLE PP R Sbjct: 3 ITSNSCSPGDPLVLERPPPR 22 >SB_1239| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 37.5 bits (83), Expect = 0.005 Identities = 16/20 (80%), Positives = 16/20 (80%) Frame = -3 Query: 89 LVPNSCSPGDPLVLEXPPGR 30 L NSCSPGDPLVLE PP R Sbjct: 3 LSSNSCSPGDPLVLERPPPR 22 >SB_58683| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 152 Score = 37.5 bits (83), Expect = 0.005 Identities = 16/20 (80%), Positives = 16/20 (80%) Frame = -3 Query: 89 LVPNSCSPGDPLVLEXPPGR 30 L NSCSPGDPLVLE PP R Sbjct: 27 LPSNSCSPGDPLVLERPPPR 46 >SB_58005| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 37.5 bits (83), Expect = 0.005 Identities = 15/20 (75%), Positives = 17/20 (85%) Frame = -3 Query: 89 LVPNSCSPGDPLVLEXPPGR 30 ++ NSCSPGDPLVLE PP R Sbjct: 2 VLSNSCSPGDPLVLERPPPR 21 >SB_54339| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 153 Score = 37.5 bits (83), Expect = 0.005 Identities = 15/20 (75%), Positives = 16/20 (80%) Frame = -3 Query: 89 LVPNSCSPGDPLVLEXPPGR 30 + NSCSPGDPLVLE PP R Sbjct: 28 IASNSCSPGDPLVLERPPPR 47 >SB_52100| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 150 Score = 37.5 bits (83), Expect = 0.005 Identities = 15/20 (75%), Positives = 16/20 (80%) Frame = -3 Query: 89 LVPNSCSPGDPLVLEXPPGR 30 + NSCSPGDPLVLE PP R Sbjct: 25 ITSNSCSPGDPLVLERPPPR 44 >SB_50614| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 37.5 bits (83), Expect = 0.005 Identities = 16/22 (72%), Positives = 17/22 (77%) Frame = -3 Query: 95 NGLVPNSCSPGDPLVLEXPPGR 30 N + NSCSPGDPLVLE PP R Sbjct: 3 NDDLSNSCSPGDPLVLERPPPR 24 >SB_49201| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 190 Score = 37.5 bits (83), Expect = 0.005 Identities = 16/20 (80%), Positives = 16/20 (80%) Frame = -3 Query: 89 LVPNSCSPGDPLVLEXPPGR 30 L NSCSPGDPLVLE PP R Sbjct: 65 LPSNSCSPGDPLVLERPPPR 84 >SB_48738| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 37.5 bits (83), Expect = 0.005 Identities = 15/20 (75%), Positives = 17/20 (85%) Frame = -3 Query: 89 LVPNSCSPGDPLVLEXPPGR 30 ++ NSCSPGDPLVLE PP R Sbjct: 23 VLSNSCSPGDPLVLERPPPR 42 >SB_48029| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 37.5 bits (83), Expect = 0.005 Identities = 15/20 (75%), Positives = 16/20 (80%) Frame = -3 Query: 89 LVPNSCSPGDPLVLEXPPGR 30 + NSCSPGDPLVLE PP R Sbjct: 13 ITSNSCSPGDPLVLERPPPR 32 >SB_46641| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 191 Score = 37.5 bits (83), Expect = 0.005 Identities = 16/20 (80%), Positives = 16/20 (80%) Frame = -3 Query: 89 LVPNSCSPGDPLVLEXPPGR 30 L NSCSPGDPLVLE PP R Sbjct: 66 LSSNSCSPGDPLVLERPPPR 85 >SB_45361| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 37.5 bits (83), Expect = 0.005 Identities = 15/20 (75%), Positives = 16/20 (80%) Frame = -3 Query: 89 LVPNSCSPGDPLVLEXPPGR 30 + NSCSPGDPLVLE PP R Sbjct: 1 MASNSCSPGDPLVLERPPPR 20 >SB_45029| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 37.5 bits (83), Expect = 0.005 Identities = 15/20 (75%), Positives = 17/20 (85%) Frame = -3 Query: 89 LVPNSCSPGDPLVLEXPPGR 30 ++ NSCSPGDPLVLE PP R Sbjct: 19 VLSNSCSPGDPLVLERPPPR 38 >SB_43466| Best HMM Match : DEAD (HMM E-Value=1.8) Length = 210 Score = 37.5 bits (83), Expect = 0.005 Identities = 16/20 (80%), Positives = 16/20 (80%) Frame = -3 Query: 89 LVPNSCSPGDPLVLEXPPGR 30 L NSCSPGDPLVLE PP R Sbjct: 85 LSSNSCSPGDPLVLERPPPR 104 >SB_43244| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 37.5 bits (83), Expect = 0.005 Identities = 15/20 (75%), Positives = 16/20 (80%) Frame = -3 Query: 89 LVPNSCSPGDPLVLEXPPGR 30 + NSCSPGDPLVLE PP R Sbjct: 4 IASNSCSPGDPLVLERPPPR 23 >SB_40073| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 171 Score = 37.5 bits (83), Expect = 0.005 Identities = 15/20 (75%), Positives = 16/20 (80%) Frame = -3 Query: 89 LVPNSCSPGDPLVLEXPPGR 30 + NSCSPGDPLVLE PP R Sbjct: 46 IASNSCSPGDPLVLERPPPR 65 >SB_37676| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 37.5 bits (83), Expect = 0.005 Identities = 15/20 (75%), Positives = 17/20 (85%) Frame = -3 Query: 89 LVPNSCSPGDPLVLEXPPGR 30 ++ NSCSPGDPLVLE PP R Sbjct: 13 VLSNSCSPGDPLVLERPPPR 32 >SB_36435| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 171 Score = 37.5 bits (83), Expect = 0.005 Identities = 15/20 (75%), Positives = 16/20 (80%) Frame = -3 Query: 89 LVPNSCSPGDPLVLEXPPGR 30 + NSCSPGDPLVLE PP R Sbjct: 46 ITSNSCSPGDPLVLERPPPR 65 >SB_35028| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 135 Score = 37.5 bits (83), Expect = 0.005 Identities = 15/20 (75%), Positives = 16/20 (80%) Frame = -3 Query: 89 LVPNSCSPGDPLVLEXPPGR 30 + NSCSPGDPLVLE PP R Sbjct: 10 ITSNSCSPGDPLVLERPPPR 29 >SB_33980| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 37.5 bits (83), Expect = 0.005 Identities = 15/20 (75%), Positives = 16/20 (80%) Frame = -3 Query: 89 LVPNSCSPGDPLVLEXPPGR 30 + NSCSPGDPLVLE PP R Sbjct: 16 ITSNSCSPGDPLVLERPPPR 35 >SB_33166| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 183 Score = 37.5 bits (83), Expect = 0.005 Identities = 17/24 (70%), Positives = 19/24 (79%), Gaps = 3/24 (12%) Frame = -3 Query: 92 GLVP---NSCSPGDPLVLEXPPGR 30 G++P NSCSPGDPLVLE PP R Sbjct: 54 GMLPRRSNSCSPGDPLVLERPPPR 77 >SB_32912| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 446 Score = 37.5 bits (83), Expect = 0.005 Identities = 16/22 (72%), Positives = 17/22 (77%) Frame = -3 Query: 95 NGLVPNSCSPGDPLVLEXPPGR 30 N + NSCSPGDPLVLE PP R Sbjct: 319 NRVRSNSCSPGDPLVLERPPPR 340 >SB_32750| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 150 Score = 37.5 bits (83), Expect = 0.005 Identities = 15/20 (75%), Positives = 16/20 (80%) Frame = -3 Query: 89 LVPNSCSPGDPLVLEXPPGR 30 + NSCSPGDPLVLE PP R Sbjct: 25 ITSNSCSPGDPLVLERPPPR 44 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 9,728,467 Number of Sequences: 59808 Number of extensions: 142100 Number of successful extensions: 2598 Number of sequences better than 10.0: 500 Number of HSP's better than 10.0 without gapping: 2583 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2598 length of database: 16,821,457 effective HSP length: 76 effective length of database: 12,276,049 effective search space used: 871599479 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -