BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbS20234 (618 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_17366| Best HMM Match : Filament (HMM E-Value=0.14) 29 2.3 SB_32194| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.0 SB_5325| Best HMM Match : Drf_FH1 (HMM E-Value=0.41) 28 5.3 SB_41668| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.0 SB_24046| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.0 SB_45697| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.0 SB_23875| Best HMM Match : Porin_3 (HMM E-Value=3.22299e-44) 28 7.0 SB_3000| Best HMM Match : Extensin_2 (HMM E-Value=0.058) 27 9.2 >SB_17366| Best HMM Match : Filament (HMM E-Value=0.14) Length = 306 Score = 29.5 bits (63), Expect = 2.3 Identities = 21/98 (21%), Positives = 46/98 (46%) Frame = +1 Query: 76 SDVPNDILEEQLYNSVVVADYDSAVEKSKHLYEEKKSEVITNVVNKLIRNNKMNCMEYAY 255 S++ +++ + NS + + + + + +E +K E+ ++++ E++ Sbjct: 36 SELREEVILLRKENSQIESTFVEKNAELRQHFEIEKEELNRKLIHEKEELRYSLEAEFSQ 95 Query: 256 NFGSRAPRTSSGIVSQLSSDLSSPKTRLSLCTSATVSL 369 F + + T SG++ QL DL KTR SA + L Sbjct: 96 KFVNESA-TQSGVIQQLDGDLRMMKTRCGELESAMLEL 132 >SB_32194| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 316 Score = 29.1 bits (62), Expect = 3.0 Identities = 19/71 (26%), Positives = 34/71 (47%) Frame = +1 Query: 157 SKHLYEEKKSEVITNVVNKLIRNNKMNCMEYAYNFGSRAPRTSSGIVSQLSSDLSSPKTR 336 S+ L +EKK E ++ + + N K + + + NF + P S +L ++ +S + Sbjct: 224 SQRLEKEKKKEWVSCIKKTEVTNRKRSLVSFLRNFATGNPFFPSFFHYELPAEEASGTST 283 Query: 337 LSLCTSATVSL 369 L T VSL Sbjct: 284 GRLITRCQVSL 294 >SB_5325| Best HMM Match : Drf_FH1 (HMM E-Value=0.41) Length = 638 Score = 28.3 bits (60), Expect = 5.3 Identities = 11/31 (35%), Positives = 17/31 (54%) Frame = +2 Query: 431 QDKPESQLEVNRSVGEQQGLLQDLEHERNQY 523 + KP S NR+ G ++G +QD +R Y Sbjct: 354 ESKPSSSSSKNRNTGLERGRVQDFGRDRRDY 384 >SB_41668| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 588 Score = 27.9 bits (59), Expect = 7.0 Identities = 18/44 (40%), Positives = 24/44 (54%) Frame = +2 Query: 71 QIPTSLTTFWRSSFTIASSSPITTVRLKRASIYTRRRRAKSSQM 202 +IPTS R SFTI P + VR R S +T RR +S++ Sbjct: 403 RIPTSRVRQTRLSFTIVRRIPTSRVRQTRLS-FTMIRRIPASRV 445 >SB_24046| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2848 Score = 27.9 bits (59), Expect = 7.0 Identities = 22/86 (25%), Positives = 40/86 (46%), Gaps = 5/86 (5%) Frame = +1 Query: 112 YNSVVVADYDSAVEKSKHLYEEKKSEVITNVVNKL--IRNNKMNCMEYAYNFGSRAPRTS 285 ++SV +DS+V + L+E KK +++ L + + N + SR P S Sbjct: 910 FHSVGGTSWDSSVADEEDLFEVKKKPDKPSLLAALKPVARQESNASLKSNKSASRIPVRS 969 Query: 286 SGIVSQLSSDLSS---PKTRLSLCTS 354 + S +S D S P +R+ + +S Sbjct: 970 DSVKSSVSVDFKSKEPPASRIPVLSS 995 >SB_45697| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 734 Score = 27.9 bits (59), Expect = 7.0 Identities = 20/80 (25%), Positives = 31/80 (38%) Frame = +1 Query: 76 SDVPNDILEEQLYNSVVVADYDSAVEKSKHLYEEKKSEVITNVVNKLIRNNKMNCMEYAY 255 SDVP + Y + + D DSA + S KS + N V + C + Sbjct: 42 SDVPEPVAASTPYQTRELRDMDSANDGSSLKKHTDKSNMAHNAVERFSTETTSVCRSVSE 101 Query: 256 NFGSRAPRTSSGIVSQLSSD 315 S+ P +S + + SD Sbjct: 102 ESQSQEPISSVLVHDESFSD 121 >SB_23875| Best HMM Match : Porin_3 (HMM E-Value=3.22299e-44) Length = 270 Score = 27.9 bits (59), Expect = 7.0 Identities = 16/30 (53%), Positives = 19/30 (63%), Gaps = 1/30 (3%) Frame = -3 Query: 610 TTGALKLSTL-VDSEGHMVAVPVSADSQYQ 524 TT + KL+ L VDS G V V ADS+YQ Sbjct: 67 TTASAKLACLQVDSRGSPTWVLVQADSEYQ 96 >SB_3000| Best HMM Match : Extensin_2 (HMM E-Value=0.058) Length = 1002 Score = 27.5 bits (58), Expect = 9.2 Identities = 18/59 (30%), Positives = 28/59 (47%), Gaps = 10/59 (16%) Frame = +3 Query: 153 KEQAFIRGEEERSHHKCREQTDTK-------QQDELHGVRLQLW---LQGSKDIVRDCF 299 K Q R EEE K +E+ T+ + D+LHG+R+ W L G +++ F Sbjct: 28 KLQEKARAEEEAKEKKRKEEDATRIAELEKPKPDKLHGLRVHCWVLVLSGKREVPESFF 86 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,861,801 Number of Sequences: 59808 Number of extensions: 309542 Number of successful extensions: 1616 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 1567 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1616 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1524174750 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -