BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbS20234 (618 letters) Database: fruitfly 53,049 sequences; 24,988,368 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY121690-1|AAM52017.1| 724|Drosophila melanogaster RE53177p pro... 29 6.6 AE014298-2880|AAF48977.2| 713|Drosophila melanogaster CG14205-P... 29 6.6 DQ991915-1|ABJ09588.1| 2176|Drosophila melanogaster eyes shut pr... 28 8.8 DQ780942-1|ABH07112.1| 2165|Drosophila melanogaster spacemaker p... 28 8.8 AY119566-1|AAM50220.1| 517|Drosophila melanogaster HL01481p pro... 28 8.8 AE014134-390|AAZ83988.1| 1984|Drosophila melanogaster CG33955-PB... 28 8.8 >AY121690-1|AAM52017.1| 724|Drosophila melanogaster RE53177p protein. Length = 724 Score = 28.7 bits (61), Expect = 6.6 Identities = 13/29 (44%), Positives = 19/29 (65%) Frame = +1 Query: 28 AIVILCLFVASLYAADSDVPNDILEEQLY 114 A++ CLF YAAD+++P I+EE Y Sbjct: 553 ALLFSCLFAVYGYAADAEIP-PIVEEAFY 580 >AE014298-2880|AAF48977.2| 713|Drosophila melanogaster CG14205-PA protein. Length = 713 Score = 28.7 bits (61), Expect = 6.6 Identities = 13/29 (44%), Positives = 19/29 (65%) Frame = +1 Query: 28 AIVILCLFVASLYAADSDVPNDILEEQLY 114 A++ CLF YAAD+++P I+EE Y Sbjct: 542 ALLFSCLFAVYGYAADAEIP-PIVEEAFY 569 >DQ991915-1|ABJ09588.1| 2176|Drosophila melanogaster eyes shut protein. Length = 2176 Score = 28.3 bits (60), Expect = 8.8 Identities = 14/30 (46%), Positives = 20/30 (66%) Frame = +2 Query: 449 QLEVNRSVGEQQGLLQDLEHERNQYLVLGV 538 Q+ +N S E GLL EHER+++L LG+ Sbjct: 1990 QVSLNFSTIEPDGLLLWSEHERSKFLGLGL 2019 >DQ780942-1|ABH07112.1| 2165|Drosophila melanogaster spacemaker protein. Length = 2165 Score = 28.3 bits (60), Expect = 8.8 Identities = 14/30 (46%), Positives = 20/30 (66%) Frame = +2 Query: 449 QLEVNRSVGEQQGLLQDLEHERNQYLVLGV 538 Q+ +N S E GLL EHER+++L LG+ Sbjct: 1979 QVSLNFSTIEPDGLLLWSEHERSKFLGLGL 2008 >AY119566-1|AAM50220.1| 517|Drosophila melanogaster HL01481p protein. Length = 517 Score = 28.3 bits (60), Expect = 8.8 Identities = 14/30 (46%), Positives = 20/30 (66%) Frame = +2 Query: 449 QLEVNRSVGEQQGLLQDLEHERNQYLVLGV 538 Q+ +N S E GLL EHER+++L LG+ Sbjct: 331 QVSLNFSTIEPDGLLLWSEHERSKFLGLGL 360 >AE014134-390|AAZ83988.1| 1984|Drosophila melanogaster CG33955-PB protein. Length = 1984 Score = 28.3 bits (60), Expect = 8.8 Identities = 14/30 (46%), Positives = 20/30 (66%) Frame = +2 Query: 449 QLEVNRSVGEQQGLLQDLEHERNQYLVLGV 538 Q+ +N S E GLL EHER+++L LG+ Sbjct: 1798 QVSLNFSTIEPDGLLLWSEHERSKFLGLGL 1827 Database: fruitfly Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 24,988,368 Number of sequences in database: 53,049 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 24,528,621 Number of Sequences: 53049 Number of extensions: 453145 Number of successful extensions: 1928 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 1877 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1928 length of database: 24,988,368 effective HSP length: 82 effective length of database: 20,638,350 effective search space used: 2538517050 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -