BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbS20234 (618 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g60170.1 68414.m06778 pre-mRNA processing ribonucleoprotein b... 33 0.11 At1g76730.1 68414.m08930 5-formyltetrahydrofolate cyclo-ligase f... 31 0.81 At4g00730.1 68417.m00099 anthocyaninless2 (ANL2) nearly identica... 29 2.5 At4g12900.1 68417.m02018 gamma interferon responsive lysosomal t... 27 7.5 At1g59453.1 68414.m06679 transcription factor-related weak simil... 27 7.5 At1g59077.1 68414.m06670 hypothetical protein 27 7.5 At1g58766.1 68414.m06659 hypothetical protein 27 7.5 At1g04120.1 68414.m00401 ABC transporter family protein Strong s... 27 7.5 At5g10060.1 68418.m01165 expressed protein 27 10.0 At2g04620.1 68415.m00470 cation efflux family protein potential ... 27 10.0 >At1g60170.1 68414.m06778 pre-mRNA processing ribonucleoprotein binding region-containing protein similar to U4/U6 snRNP-associated 61 kDa protein [Homo sapiens] GI:18249847; contains Pfam profile PF01798: Putative snoRNA binding domain Length = 485 Score = 33.5 bits (73), Expect = 0.11 Identities = 18/67 (26%), Positives = 32/67 (47%) Frame = +1 Query: 4 LDAPKMKPAIVILCLFVASLYAADSDVPNDILEEQLYNSVVVADYDSAVEKSKHLYEEKK 183 +D + P+ +I+ + V +L S +P D+L++ L D DSA +K E K Sbjct: 154 VDLADLLPSAIIMVVSVTALTTKGSALPEDVLQKVLEACDRALDLDSARKKVLEFVESKM 213 Query: 184 SEVITNV 204 + N+ Sbjct: 214 GSIAPNL 220 >At1g76730.1 68414.m08930 5-formyltetrahydrofolate cyclo-ligase family protein contains Pfam profile PF01812 5-formyltetrahydrofolate cyclo-ligase Length = 354 Score = 30.7 bits (66), Expect = 0.81 Identities = 14/31 (45%), Positives = 18/31 (58%) Frame = +1 Query: 274 PRTSSGIVSQLSSDLSSPKTRLSLCTSATVS 366 PR +G S L SDL P+T + CTS V+ Sbjct: 171 PRLRTGFFSVLESDLLKPETIMEACTSVGVA 201 >At4g00730.1 68417.m00099 anthocyaninless2 (ANL2) nearly identical to Anthocyaninless2 [Arabidopsis thaliana] GI:5702094 Length = 802 Score = 29.1 bits (62), Expect = 2.5 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = +2 Query: 506 HERNQYLVLGVGTNWNGDHMAF 571 H N L L VGTN NG H AF Sbjct: 271 HHYNSSLELAVGTNNNGGHFAF 292 >At4g12900.1 68417.m02018 gamma interferon responsive lysosomal thiol reductase family protein / GILT family protein similar to SP|P13284 Gamma-interferon inducible lysosomal thiol reductase precursor {Homo sapiens}; contains Pfam profile PF03227: Gamma interferon inducible lysosomal thiol reductase (GILT) Length = 231 Score = 27.5 bits (58), Expect = 7.5 Identities = 10/28 (35%), Positives = 16/28 (57%) Frame = +3 Query: 462 IALWENNKVYFKILNTNVTNTWYWESAL 545 I W N ++++K + TNT WES + Sbjct: 107 IRTWPNQRLHYKFIRCVETNTNAWESCV 134 >At1g59453.1 68414.m06679 transcription factor-related weak similarity to TFIIIC Box B-binding subunit [Homo sapiens] GI:442362 Length = 1729 Score = 27.5 bits (58), Expect = 7.5 Identities = 14/37 (37%), Positives = 21/37 (56%), Gaps = 1/37 (2%) Frame = +1 Query: 97 LEEQLYNSVVVADYDSAVEKSKHLYEEKKSEV-ITNV 204 LEE N VV +DY ++ +K H+ E +V I N+ Sbjct: 1545 LEEHRSNDVVTSDYSTSKDKQVHVSENSVHKVTILNI 1581 >At1g59077.1 68414.m06670 hypothetical protein Length = 665 Score = 27.5 bits (58), Expect = 7.5 Identities = 14/37 (37%), Positives = 21/37 (56%), Gaps = 1/37 (2%) Frame = +1 Query: 97 LEEQLYNSVVVADYDSAVEKSKHLYEEKKSEV-ITNV 204 LEE N VV +DY ++ +K H+ E +V I N+ Sbjct: 481 LEEHRSNDVVTSDYSTSKDKQVHVSENSVHKVTILNI 517 >At1g58766.1 68414.m06659 hypothetical protein Length = 665 Score = 27.5 bits (58), Expect = 7.5 Identities = 14/37 (37%), Positives = 21/37 (56%), Gaps = 1/37 (2%) Frame = +1 Query: 97 LEEQLYNSVVVADYDSAVEKSKHLYEEKKSEV-ITNV 204 LEE N VV +DY ++ +K H+ E +V I N+ Sbjct: 481 LEEHRSNDVVTSDYSTSKDKQVHVSENSVHKVTILNI 517 >At1g04120.1 68414.m00401 ABC transporter family protein Strong similarity to MRP-like ABC transporter gb|U92650 from A. thaliana and canalicular multi-drug resistance protein gb|L49379 from Rattus norvegicus Length = 1514 Score = 27.5 bits (58), Expect = 7.5 Identities = 8/32 (25%), Positives = 18/32 (56%) Frame = +2 Query: 50 SWHLCMLQIPTSLTTFWRSSFTIASSSPITTV 145 +W + +L +P ++ FW + +ASS + + Sbjct: 1086 TWQVFLLVVPVAVACFWMQKYYMASSRELVRI 1117 >At5g10060.1 68418.m01165 expressed protein Length = 469 Score = 27.1 bits (57), Expect = 10.0 Identities = 14/51 (27%), Positives = 24/51 (47%) Frame = +1 Query: 151 EKSKHLYEEKKSEVITNVVNKLIRNNKMNCMEYAYNFGSRAPRTSSGIVSQ 303 EK H E + + + N +++N+K E+ F + P+ IVSQ Sbjct: 46 EKQFHSTEMDQKVPLLYLANDILQNSKRQGNEFVQEFWNVLPKALKDIVSQ 96 >At2g04620.1 68415.m00470 cation efflux family protein potential member of the cation diffusion facilitator (CDF) family, or cation efflux (CE) family, see PMID:11500563 Length = 798 Score = 27.1 bits (57), Expect = 10.0 Identities = 9/21 (42%), Positives = 16/21 (76%) Frame = -1 Query: 114 VKLLLQNVVRDVGICSIQRCH 52 +K ++N+++ G+CSIQR H Sbjct: 727 LKEAMRNILKTKGVCSIQRLH 747 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,850,198 Number of Sequences: 28952 Number of extensions: 217692 Number of successful extensions: 879 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 858 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 879 length of database: 12,070,560 effective HSP length: 78 effective length of database: 9,812,304 effective search space used: 1246162608 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -