BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbS20232 (545 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ435333-1|ABD92648.1| 135|Apis mellifera OBP16 protein. 24 0.88 AB072429-1|BAB83990.1| 388|Apis mellifera IP3phosphatase protein. 22 3.5 >DQ435333-1|ABD92648.1| 135|Apis mellifera OBP16 protein. Length = 135 Score = 24.2 bits (50), Expect = 0.88 Identities = 9/27 (33%), Positives = 15/27 (55%) Frame = +3 Query: 138 KIFDTIYKGTEPIVESIINTYVETVKK 218 KI D +Y G + + + +YVE + K Sbjct: 42 KIIDEVYNGNVNVEDENVQSYVECMMK 68 >AB072429-1|BAB83990.1| 388|Apis mellifera IP3phosphatase protein. Length = 388 Score = 22.2 bits (45), Expect = 3.5 Identities = 15/49 (30%), Positives = 26/49 (53%), Gaps = 1/49 (2%) Frame = +3 Query: 12 PYFKKIDEDFRREWSKFYQEVTDDKTLKELSHAFN-EIIQFFAKIFDTI 155 PYF D +FR + + +++T+D + LS+ + +QF K D I Sbjct: 222 PYFLFGDFNFRTDTAGVIKKLTEDTQERRLSNKGSISKLQFHNKDDDLI 270 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 141,364 Number of Sequences: 438 Number of extensions: 2627 Number of successful extensions: 5 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 146,343 effective HSP length: 54 effective length of database: 122,691 effective search space used: 15581757 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -