BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbS20228 (517 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value Y13429-1|CAA73841.1| 402|Apis mellifera dopamine receptor, D1 p... 24 0.81 DQ000307-1|AAY21180.1| 423|Apis mellifera major royal jelly pro... 24 1.1 AF498306-5|AAM19330.1| 456|Apis mellifera dopamine receptor typ... 24 1.1 AM076717-1|CAJ28210.1| 501|Apis mellifera serotonin receptor pr... 23 2.5 DQ863218-1|ABI94394.1| 399|Apis mellifera tyramine receptor pro... 22 3.3 DQ863217-1|ABI94393.1| 399|Apis mellifera tyramine receptor pro... 22 3.3 DQ325067-1|ABD14081.1| 152|Apis mellifera complementary sex det... 22 3.3 DQ325066-1|ABD14080.1| 152|Apis mellifera complementary sex det... 22 3.3 DQ325065-1|ABD14079.1| 152|Apis mellifera complementary sex det... 22 3.3 DQ325064-1|ABD14078.1| 152|Apis mellifera complementary sex det... 22 3.3 DQ325063-1|ABD14077.1| 152|Apis mellifera complementary sex det... 22 3.3 DQ325062-1|ABD14076.1| 152|Apis mellifera complementary sex det... 22 3.3 DQ325061-1|ABD14075.1| 152|Apis mellifera complementary sex det... 22 3.3 AY569719-1|AAS86672.1| 401|Apis mellifera feminizer protein. 22 3.3 AY569718-1|AAS86671.1| 401|Apis mellifera feminizer protein. 22 3.3 AY569715-1|AAS86668.1| 401|Apis mellifera feminizer protein. 22 3.3 AY569714-1|AAS86667.1| 401|Apis mellifera feminizer protein. 22 3.3 AY569713-1|AAS86666.1| 401|Apis mellifera feminizer protein. 22 3.3 AY569711-1|AAS86664.1| 401|Apis mellifera feminizer protein. 22 3.3 AY352276-1|AAQ67417.1| 385|Apis mellifera complementary sex det... 22 3.3 AY350616-1|AAQ57658.1| 401|Apis mellifera complementary sex det... 22 3.3 AJ245824-1|CAB76374.1| 399|Apis mellifera G-protein coupled rec... 22 3.3 AB270697-1|BAF75928.1| 735|Apis mellifera FoxP protein protein. 22 3.3 DQ201783-1|ABB05503.1| 381|Apis mellifera capa receptor-like GP... 21 7.5 AY769960-1|AAV34676.1| 603|Apis mellifera soluble guanylyl cycl... 21 7.5 AF084556-1|AAC71015.1| 652|Apis mellifera pipsqueak protein. 21 7.5 AB244761-1|BAE66603.1| 504|Apis mellifera cystathionine beta-sy... 21 7.5 AB181489-1|BAD22772.1| 603|Apis mellifera soluble guanylyl cycl... 21 7.5 AF388659-4|AAK71996.1| 1308|Apis mellifera NFRKB-like protein pr... 21 10.0 >Y13429-1|CAA73841.1| 402|Apis mellifera dopamine receptor, D1 protein. Length = 402 Score = 24.2 bits (50), Expect = 0.81 Identities = 9/35 (25%), Positives = 17/35 (48%) Frame = -3 Query: 164 TKVVLPVPPSPTNTHLNVGISSAIFVVLWLFYFVI 60 TK P S + VG+ +F++ W+ +F + Sbjct: 257 TKPTSPYHVSDHKAAITVGVIMGVFLICWVPFFCV 291 >DQ000307-1|AAY21180.1| 423|Apis mellifera major royal jelly protein 9 protein. Length = 423 Score = 23.8 bits (49), Expect = 1.1 Identities = 10/24 (41%), Positives = 15/24 (62%) Frame = +3 Query: 207 DSGCRSTSSSIPYEPRPIRFNVXD 278 DS R TSS+ Y+PR ++ + D Sbjct: 218 DSFQRLTSSTFVYDPRYTKYTIND 241 >AF498306-5|AAM19330.1| 456|Apis mellifera dopamine receptor type D2 protein. Length = 456 Score = 23.8 bits (49), Expect = 1.1 Identities = 7/18 (38%), Positives = 13/18 (72%) Frame = -3 Query: 113 VGISSAIFVVLWLFYFVI 60 +GI +F++ WL +FV+ Sbjct: 337 LGIVMGVFIICWLPFFVV 354 >AM076717-1|CAJ28210.1| 501|Apis mellifera serotonin receptor protein. Length = 501 Score = 22.6 bits (46), Expect = 2.5 Identities = 8/18 (44%), Positives = 13/18 (72%) Frame = -3 Query: 113 VGISSAIFVVLWLFYFVI 60 +GI + F+V WL +FV+ Sbjct: 374 LGIIMSAFIVCWLPFFVL 391 >DQ863218-1|ABI94394.1| 399|Apis mellifera tyramine receptor protein. Length = 399 Score = 22.2 bits (45), Expect = 3.3 Identities = 7/18 (38%), Positives = 13/18 (72%) Frame = -3 Query: 113 VGISSAIFVVLWLFYFVI 60 +G+ +FVV WL +F++ Sbjct: 329 LGVIMGVFVVCWLPFFLM 346 >DQ863217-1|ABI94393.1| 399|Apis mellifera tyramine receptor protein. Length = 399 Score = 22.2 bits (45), Expect = 3.3 Identities = 7/18 (38%), Positives = 13/18 (72%) Frame = -3 Query: 113 VGISSAIFVVLWLFYFVI 60 +G+ +FVV WL +F++ Sbjct: 329 LGVIMGVFVVCWLPFFLM 346 >DQ325067-1|ABD14081.1| 152|Apis mellifera complementary sex determiner protein. Length = 152 Score = 22.2 bits (45), Expect = 3.3 Identities = 9/15 (60%), Positives = 11/15 (73%) Frame = -3 Query: 428 IPSHTRDQISMPVRY 384 IPSH +QI +PV Y Sbjct: 82 IPSHYIEQIPVPVYY 96 >DQ325066-1|ABD14080.1| 152|Apis mellifera complementary sex determiner protein. Length = 152 Score = 22.2 bits (45), Expect = 3.3 Identities = 9/15 (60%), Positives = 11/15 (73%) Frame = -3 Query: 428 IPSHTRDQISMPVRY 384 IPSH +QI +PV Y Sbjct: 82 IPSHYIEQIPVPVYY 96 >DQ325065-1|ABD14079.1| 152|Apis mellifera complementary sex determiner protein. Length = 152 Score = 22.2 bits (45), Expect = 3.3 Identities = 9/15 (60%), Positives = 11/15 (73%) Frame = -3 Query: 428 IPSHTRDQISMPVRY 384 IPSH +QI +PV Y Sbjct: 82 IPSHYIEQIPVPVYY 96 >DQ325064-1|ABD14078.1| 152|Apis mellifera complementary sex determiner protein. Length = 152 Score = 22.2 bits (45), Expect = 3.3 Identities = 9/15 (60%), Positives = 11/15 (73%) Frame = -3 Query: 428 IPSHTRDQISMPVRY 384 IPSH +QI +PV Y Sbjct: 82 IPSHYIEQIPVPVYY 96 >DQ325063-1|ABD14077.1| 152|Apis mellifera complementary sex determiner protein. Length = 152 Score = 22.2 bits (45), Expect = 3.3 Identities = 9/15 (60%), Positives = 11/15 (73%) Frame = -3 Query: 428 IPSHTRDQISMPVRY 384 IPSH +QI +PV Y Sbjct: 82 IPSHYIEQIPVPVYY 96 >DQ325062-1|ABD14076.1| 152|Apis mellifera complementary sex determiner protein. Length = 152 Score = 22.2 bits (45), Expect = 3.3 Identities = 9/15 (60%), Positives = 11/15 (73%) Frame = -3 Query: 428 IPSHTRDQISMPVRY 384 IPSH +QI +PV Y Sbjct: 82 IPSHYIEQIPVPVYY 96 >DQ325061-1|ABD14075.1| 152|Apis mellifera complementary sex determiner protein. Length = 152 Score = 22.2 bits (45), Expect = 3.3 Identities = 9/15 (60%), Positives = 11/15 (73%) Frame = -3 Query: 428 IPSHTRDQISMPVRY 384 IPSH +QI +PV Y Sbjct: 82 IPSHYIEQIPVPVYY 96 >AY569719-1|AAS86672.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 22.2 bits (45), Expect = 3.3 Identities = 9/15 (60%), Positives = 11/15 (73%) Frame = -3 Query: 428 IPSHTRDQISMPVRY 384 IPSH +QI +PV Y Sbjct: 331 IPSHYIEQIPVPVYY 345 >AY569718-1|AAS86671.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 22.2 bits (45), Expect = 3.3 Identities = 9/15 (60%), Positives = 11/15 (73%) Frame = -3 Query: 428 IPSHTRDQISMPVRY 384 IPSH +QI +PV Y Sbjct: 331 IPSHYIEQIPVPVYY 345 >AY569715-1|AAS86668.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 22.2 bits (45), Expect = 3.3 Identities = 9/15 (60%), Positives = 11/15 (73%) Frame = -3 Query: 428 IPSHTRDQISMPVRY 384 IPSH +QI +PV Y Sbjct: 331 IPSHYIEQIPVPVYY 345 >AY569714-1|AAS86667.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 22.2 bits (45), Expect = 3.3 Identities = 9/15 (60%), Positives = 11/15 (73%) Frame = -3 Query: 428 IPSHTRDQISMPVRY 384 IPSH +QI +PV Y Sbjct: 331 IPSHYIEQIPVPVYY 345 >AY569713-1|AAS86666.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 22.2 bits (45), Expect = 3.3 Identities = 9/15 (60%), Positives = 11/15 (73%) Frame = -3 Query: 428 IPSHTRDQISMPVRY 384 IPSH +QI +PV Y Sbjct: 331 IPSHYIEQIPVPVYY 345 >AY569711-1|AAS86664.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 22.2 bits (45), Expect = 3.3 Identities = 9/15 (60%), Positives = 11/15 (73%) Frame = -3 Query: 428 IPSHTRDQISMPVRY 384 IPSH +QI +PV Y Sbjct: 331 IPSHYIEQIPVPVYY 345 >AY352276-1|AAQ67417.1| 385|Apis mellifera complementary sex determiner protein. Length = 385 Score = 22.2 bits (45), Expect = 3.3 Identities = 9/15 (60%), Positives = 11/15 (73%) Frame = -3 Query: 428 IPSHTRDQISMPVRY 384 IPSH +QI +PV Y Sbjct: 315 IPSHYIEQIPVPVYY 329 >AY350616-1|AAQ57658.1| 401|Apis mellifera complementary sex determiner protein. Length = 401 Score = 22.2 bits (45), Expect = 3.3 Identities = 9/15 (60%), Positives = 11/15 (73%) Frame = -3 Query: 428 IPSHTRDQISMPVRY 384 IPSH +QI +PV Y Sbjct: 331 IPSHYIEQIPVPVYY 345 >AJ245824-1|CAB76374.1| 399|Apis mellifera G-protein coupled receptor protein. Length = 399 Score = 22.2 bits (45), Expect = 3.3 Identities = 7/18 (38%), Positives = 13/18 (72%) Frame = -3 Query: 113 VGISSAIFVVLWLFYFVI 60 +G+ +FVV WL +F++ Sbjct: 329 LGVIMGVFVVCWLPFFLM 346 >AB270697-1|BAF75928.1| 735|Apis mellifera FoxP protein protein. Length = 735 Score = 22.2 bits (45), Expect = 3.3 Identities = 12/44 (27%), Positives = 20/44 (45%) Frame = +3 Query: 213 GCRSTSSSIPYEPRPIRFNVXDTAGQEKFGGLRDGYYIQGQXAI 344 G T ++P PIR + D + GGL D ++ + A+ Sbjct: 437 GSMPTMPTMPSMAGPIRRRISDKSALSLAGGLYDEGTVRRRVAV 480 >DQ201783-1|ABB05503.1| 381|Apis mellifera capa receptor-like GPCR protein. Length = 381 Score = 21.0 bits (42), Expect = 7.5 Identities = 12/49 (24%), Positives = 25/49 (51%) Frame = -3 Query: 509 LFLWKTIVFALTFLSLISTLFPHKXIGIPSHTRDQISMPVRYIFVRNSR 363 L+ TI+F L + +I ++ + I + T+D ++ V+ +SR Sbjct: 212 LYELSTIIFFLIPMLIILVVYTRMGLKIRNSTKDTLNSVVQGAIHGDSR 260 >AY769960-1|AAV34676.1| 603|Apis mellifera soluble guanylyl cyclase beta 1 subunit protein. Length = 603 Score = 21.0 bits (42), Expect = 7.5 Identities = 6/11 (54%), Positives = 8/11 (72%) Frame = -1 Query: 319 YPSLRPPNFSC 287 YP +R P+F C Sbjct: 112 YPGMRAPSFRC 122 >AF084556-1|AAC71015.1| 652|Apis mellifera pipsqueak protein. Length = 652 Score = 21.0 bits (42), Expect = 7.5 Identities = 8/19 (42%), Positives = 12/19 (63%) Frame = -1 Query: 106 YHLPFSLFYGYFTS*LYKK 50 Y+LP+S YG F Y++ Sbjct: 598 YNLPYSSLYGRFKRGKYEE 616 >AB244761-1|BAE66603.1| 504|Apis mellifera cystathionine beta-synthase protein. Length = 504 Score = 21.0 bits (42), Expect = 7.5 Identities = 10/32 (31%), Positives = 19/32 (59%) Frame = -3 Query: 371 NSRGYVEHDDSXLSLNIVSVSKTTKLLLSGCV 276 +S+ V DD+ ++S++K T ++SG V Sbjct: 401 DSQLLVISDDNIHIKGVISLNKLTSYVISGIV 432 >AB181489-1|BAD22772.1| 603|Apis mellifera soluble guanylyl cyclase beta 1 subunit protein. Length = 603 Score = 21.0 bits (42), Expect = 7.5 Identities = 6/11 (54%), Positives = 8/11 (72%) Frame = -1 Query: 319 YPSLRPPNFSC 287 YP +R P+F C Sbjct: 112 YPGMRAPSFRC 122 >AF388659-4|AAK71996.1| 1308|Apis mellifera NFRKB-like protein protein. Length = 1308 Score = 20.6 bits (41), Expect = 10.0 Identities = 8/18 (44%), Positives = 12/18 (66%) Frame = +1 Query: 118 KCVLVGDGGTGKTTFVKR 171 K +L G G G+T F+K+ Sbjct: 1034 KSLLTGHGLQGQTIFIKQ 1051 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 156,202 Number of Sequences: 438 Number of extensions: 3285 Number of successful extensions: 29 Number of sequences better than 10.0: 29 Number of HSP's better than 10.0 without gapping: 29 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 29 length of database: 146,343 effective HSP length: 54 effective length of database: 122,691 effective search space used: 14354847 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -