BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbS20222 (488 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY338499-1|AAR08420.1| 500|Apis mellifera Kruppel-like protein ... 22 4.0 AY855337-1|AAW47987.1| 510|Apis mellifera tyrosine hydroxylase ... 21 5.3 DQ257416-1|ABB81847.1| 552|Apis mellifera yellow-h protein. 21 7.0 AB253416-1|BAE86927.1| 580|Apis mellifera alpha-glucosidase pro... 21 9.3 >AY338499-1|AAR08420.1| 500|Apis mellifera Kruppel-like protein 1 protein. Length = 500 Score = 21.8 bits (44), Expect = 4.0 Identities = 11/44 (25%), Positives = 19/44 (43%) Frame = +2 Query: 113 PFTNIVLKWHTPIFLNTSSSGTQVWVNHVYSFNSRTKDSNRCMI 244 P TNI K + + + ++ +H+ S +D RC I Sbjct: 53 PLTNIEEKTYQCLLCQKAFDQKNLYQSHLRSHGKEGEDPYRCNI 96 >AY855337-1|AAW47987.1| 510|Apis mellifera tyrosine hydroxylase protein. Length = 510 Score = 21.4 bits (43), Expect = 5.3 Identities = 7/11 (63%), Positives = 8/11 (72%) Frame = -1 Query: 284 NCDHPSTKFNP 252 NC+H TKF P Sbjct: 183 NCNHLMTKFEP 193 >DQ257416-1|ABB81847.1| 552|Apis mellifera yellow-h protein. Length = 552 Score = 21.0 bits (42), Expect = 7.0 Identities = 11/24 (45%), Positives = 14/24 (58%) Frame = +2 Query: 167 SSGTQVWVNHVYSFNSRTKDSNRC 238 SSG+ + N V FN T+DS C Sbjct: 436 SSGSVIDRNGVMFFNMVTRDSVWC 459 >AB253416-1|BAE86927.1| 580|Apis mellifera alpha-glucosidase protein. Length = 580 Score = 20.6 bits (41), Expect = 9.3 Identities = 8/24 (33%), Positives = 13/24 (54%) Frame = +3 Query: 390 YDITRRETFNXLTTWLEDARQHSN 461 Y + ET++ L +W +HSN Sbjct: 257 YTRDQSETYDVLRSWRNLMDEHSN 280 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 131,562 Number of Sequences: 438 Number of extensions: 3124 Number of successful extensions: 4 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of database: 146,343 effective HSP length: 53 effective length of database: 123,129 effective search space used: 13421061 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -