BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbS20220 (490 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 08_02_1195 - 25149891-25151402,25152194-25152493 31 0.66 02_01_0420 + 3076493-3076646,3076721-3077704,3078013-3078824 27 8.1 >08_02_1195 - 25149891-25151402,25152194-25152493 Length = 603 Score = 30.7 bits (66), Expect = 0.66 Identities = 13/33 (39%), Positives = 18/33 (54%) Frame = -1 Query: 373 CNWGKNNKPKYLFLKYGKLRNETSFF*TKNITW 275 C + KN PKYL K + N SF +N++W Sbjct: 450 CTFQKNGPPKYLDPKEDRQENFASFVALRNLSW 482 >02_01_0420 + 3076493-3076646,3076721-3077704,3078013-3078824 Length = 649 Score = 27.1 bits (57), Expect = 8.1 Identities = 10/18 (55%), Positives = 13/18 (72%) Frame = -2 Query: 192 FSGDTYRKTALLGSHSKC 139 FSG+TY KT + +HS C Sbjct: 101 FSGNTYNKTTTIITHSDC 118 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,124,597 Number of Sequences: 37544 Number of extensions: 195543 Number of successful extensions: 265 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 261 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 265 length of database: 14,793,348 effective HSP length: 77 effective length of database: 11,902,460 effective search space used: 1011709100 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -