BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbS20220 (490 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g12900.1 68418.m01480 expressed protein 28 3.9 At3g05340.1 68416.m00582 pentatricopeptide (PPR) repeat-containi... 28 3.9 >At5g12900.1 68418.m01480 expressed protein Length = 562 Score = 27.9 bits (59), Expect = 3.9 Identities = 15/47 (31%), Positives = 25/47 (53%) Frame = -1 Query: 415 ITTESCHVDITTSQCNWGKNNKPKYLFLKYGKLRNETSFF*TKNITW 275 I ++S + D C + KN KPK L + + N +SF +N++W Sbjct: 391 IISQSVYQDF--ENCVFQKNGKPKLLDPEQDRQANFSSFASLRNLSW 435 >At3g05340.1 68416.m00582 pentatricopeptide (PPR) repeat-containing protein contains INTERPRO:IPR002885 PPR repeats Length = 658 Score = 27.9 bits (59), Expect = 3.9 Identities = 11/28 (39%), Positives = 17/28 (60%) Frame = -2 Query: 219 INKLF*MRNFSGDTYRKTALLGSHSKCG 136 ++ L R FSG+T+ L+ +SKCG Sbjct: 379 LHSLVIKRKFSGNTFVNNGLINMYSKCG 406 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 9,574,503 Number of Sequences: 28952 Number of extensions: 178188 Number of successful extensions: 303 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 297 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 303 length of database: 12,070,560 effective HSP length: 76 effective length of database: 9,870,208 effective search space used: 848837888 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -