BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbS20215 (522 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g59210.2 68418.m07421 myosin heavy chain-related contains wea... 33 0.088 At5g59210.1 68418.m07420 myosin heavy chain-related contains wea... 33 0.088 At5g10290.1 68418.m01194 leucine-rich repeat family protein / pr... 31 0.36 At1g69390.1 68414.m07966 chloroplast division protein, putative ... 30 1.1 At4g13310.2 68417.m02080 cytochrome P450 71A20, putative (CYP71A... 28 3.3 At4g13310.1 68417.m02081 cytochrome P450 71A20, putative (CYP71A... 28 3.3 At2g15490.1 68415.m01772 UDP-glucoronosyl/UDP-glucosyl transfera... 28 3.3 At3g43890.1 68416.m04698 DC1 domain-containing protein contains ... 27 5.8 At1g19025.1 68414.m02368 DNA cross-link repair protein-related c... 27 5.8 >At5g59210.2 68418.m07421 myosin heavy chain-related contains weak similarity to Myosin heavy chain, gizzard smooth muscle (Swiss-Prot:P10587) [Gallus gallus] Length = 433 Score = 33.5 bits (73), Expect = 0.088 Identities = 23/69 (33%), Positives = 36/69 (52%), Gaps = 3/69 (4%) Frame = +2 Query: 77 ELSADTSNQDLE-EKLY--NSILTGDYDSAVRQSLEYESQGKGSIIQNVVNNLIIDKRRN 247 +L + NQ E EKL+ NS L+ Y ++ S ++E+Q K + QNV ++DK R Sbjct: 285 KLLMEIDNQSSEIEKLFEENSNLSASYQESINISNQWENQVKECLKQNVELREVLDKLRT 344 Query: 248 TMGTATSCG 274 + S G Sbjct: 345 EQAGSFSRG 353 >At5g59210.1 68418.m07420 myosin heavy chain-related contains weak similarity to Myosin heavy chain, gizzard smooth muscle (Swiss-Prot:P10587) [Gallus gallus] Length = 434 Score = 33.5 bits (73), Expect = 0.088 Identities = 23/69 (33%), Positives = 36/69 (52%), Gaps = 3/69 (4%) Frame = +2 Query: 77 ELSADTSNQDLE-EKLY--NSILTGDYDSAVRQSLEYESQGKGSIIQNVVNNLIIDKRRN 247 +L + NQ E EKL+ NS L+ Y ++ S ++E+Q K + QNV ++DK R Sbjct: 286 KLLMEIDNQSSEIEKLFEENSNLSASYQESINISNQWENQVKECLKQNVELREVLDKLRT 345 Query: 248 TMGTATSCG 274 + S G Sbjct: 346 EQAGSFSRG 354 >At5g10290.1 68418.m01194 leucine-rich repeat family protein / protein kinase family protein contains Pfam domains PF00560: Leucine Rich Repeat and PF00069: Protein kinase domain Length = 613 Score = 31.5 bits (68), Expect = 0.36 Identities = 16/61 (26%), Positives = 30/61 (49%) Frame = +2 Query: 116 KLYNSILTGDYDSAVRQSLEYESQGKGSIIQNVVNNLIIDKRRNTMGTATSCGSATDRKL 295 K+Y +L + AV++ ++ES G + Q V + + RN + C + T+R L Sbjct: 303 KVYKGVLPDNTKVAVKRLTDFESPGGDAAFQREVEMISVAVHRNLLRLIGFCTTQTERLL 362 Query: 296 L 298 + Sbjct: 363 V 363 >At1g69390.1 68414.m07966 chloroplast division protein, putative (MinE1) identical to chloroplast division protein homolog MinE1 GI:17511220 from [Arabidopsis thaliana] Length = 229 Score = 29.9 bits (64), Expect = 1.1 Identities = 14/34 (41%), Positives = 21/34 (61%) Frame = +2 Query: 50 MLAASAGVVELSADTSNQDLEEKLYNSILTGDYD 151 +LA + G ELS + Q++E LYN+I G +D Sbjct: 70 VLARNTGDYELSPSPAEQEIESFLYNAINMGFFD 103 >At4g13310.2 68417.m02080 cytochrome P450 71A20, putative (CYP71A20) Identical to Cytochrome P450 (SP:Q9T0K2) [Arabidopsis thaliana]; similar to cytochrome P450 71A4, Solanum melongena, PIR2:S36805 Length = 390 Score = 28.3 bits (60), Expect = 3.3 Identities = 15/39 (38%), Positives = 22/39 (56%) Frame = +2 Query: 116 KLYNSILTGDYDSAVRQSLEYESQGKGSIIQNVVNNLII 232 K+ + IL+G D A EY Q K IQN++NN ++ Sbjct: 103 KVVDKILSGGRDVAFAPYGEYWRQMKSICIQNLLNNKMV 141 >At4g13310.1 68417.m02081 cytochrome P450 71A20, putative (CYP71A20) Identical to Cytochrome P450 (SP:Q9T0K2) [Arabidopsis thaliana]; similar to cytochrome P450 71A4, Solanum melongena, PIR2:S36805 Length = 497 Score = 28.3 bits (60), Expect = 3.3 Identities = 15/39 (38%), Positives = 22/39 (56%) Frame = +2 Query: 116 KLYNSILTGDYDSAVRQSLEYESQGKGSIIQNVVNNLII 232 K+ + IL+G D A EY Q K IQN++NN ++ Sbjct: 103 KVVDKILSGGRDVAFAPYGEYWRQMKSICIQNLLNNKMV 141 >At2g15490.1 68415.m01772 UDP-glucoronosyl/UDP-glucosyl transferase family protein contains Pfam profile: PF00201 UDP-glucoronosyl and UDP-glucosyl transferase Length = 484 Score = 28.3 bits (60), Expect = 3.3 Identities = 14/50 (28%), Positives = 25/50 (50%) Frame = +2 Query: 125 NSILTGDYDSAVRQSLEYESQGKGSIIQNVVNNLIIDKRRNTMGTATSCG 274 N + TG+ + + + E ++GKG II+ ++I + G T CG Sbjct: 326 NQVGTGENEDWLPKGFEERNKGKGLIIRGWAPQVLILDHKAIGGFVTHCG 375 >At3g43890.1 68416.m04698 DC1 domain-containing protein contains Pfam profile PF03107: DC1 domain Length = 661 Score = 27.5 bits (58), Expect = 5.8 Identities = 17/40 (42%), Positives = 22/40 (55%), Gaps = 5/40 (12%) Frame = +3 Query: 24 NFSLYLRCACSPPAR--ASLN---YPRTLLTKTSRRNCTT 128 NFSL L+C PP + LN +P TL+ K+ CTT Sbjct: 228 NFSLDLQCVFHPPKQNPHDLNIHDHPLTLMPKSISFTCTT 267 >At1g19025.1 68414.m02368 DNA cross-link repair protein-related contains weak similarity to Swiss-Prot:P30620 DNA cross-LINK repair protein PSO2/SNM1 [Saccharomyces cerevisiae] Length = 549 Score = 27.5 bits (58), Expect = 5.8 Identities = 17/52 (32%), Positives = 25/52 (48%), Gaps = 3/52 (5%) Frame = +1 Query: 286 QEIVRKYXPLNFRLIIGRKLCQD---HLQKLQPRSEARVPQPIPRMRELPTA 432 +E V K F ++ C+D L+KL A VP+P+P + EL A Sbjct: 488 EETVEKESCTIFSTSTSKETCKDLSGDLRKLYRSMNAPVPRPLPSLMELMNA 539 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,897,516 Number of Sequences: 28952 Number of extensions: 213751 Number of successful extensions: 571 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 561 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 571 length of database: 12,070,560 effective HSP length: 76 effective length of database: 9,870,208 effective search space used: 957410176 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -