BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbS20212 (378 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 01_05_0295 + 20537147-20537291,20539111-20539283,20539365-205395... 62 1e-10 01_05_0296 + 20567259-20567386,20568895-20569123,20569205-205694... 60 8e-10 10_08_0553 - 18720436-18720494,18721102-18721106,18721136-187212... 48 2e-06 04_04_0613 + 26617677-26617963,26618726-26618786,26619598-266198... 48 2e-06 02_05_0096 + 25785995-25786311,25786716-25786776,25787825-257880... 48 2e-06 07_03_1392 - 26238885-26239007,26239137-26239235,26239636-262397... 38 0.002 06_03_0337 + 19678152-19678484,19678616-19678801,19679232-196794... 38 0.002 03_05_0052 - 20293197-20293310,20293938-20294024,20294133-202942... 38 0.002 01_06_0020 + 25630728-25631023,25631308-25631548,25631629-256317... 38 0.002 01_05_0721 + 24594815-24594834,24595207-24595313,24595417-245954... 38 0.003 12_02_0340 - 17725866-17725884,17726046-17726326,17726842-177269... 37 0.005 06_03_1284 - 28988287-28988922,28989335-28989765,28989850-289899... 37 0.005 02_01_0355 + 2558792-2558862,2558993-2559099,2559185-2559615,256... 37 0.005 01_05_0722 + 24598426-24598649,24599113-24599219,24599319-245993... 37 0.006 07_03_0601 - 19872780-19873099,19873148-19873151,19874196-198743... 36 0.008 03_02_0758 + 10954268-10954841,10955988-10957145,10957176-109572... 36 0.008 06_03_0674 + 23422004-23422552,23423295-23423369,23424360-234244... 36 0.014 02_05_1293 - 35520733-35520963,35521696-35521878,35522040-355222... 35 0.024 05_01_0079 + 531617-531734,531987-532059,532152-532261,532400-53... 34 0.032 03_05_0997 + 29565311-29565664,29566134-29566298,29566572-295666... 33 0.075 01_07_0333 - 42813789-42814073,42814229-42814315,42815083-428151... 33 0.075 09_03_0167 + 12965030-12965356,12966100-12966387,12966704-129668... 33 0.099 08_01_0397 - 3509186-3510291,3510322-3512335 33 0.099 04_04_0476 - 25508952-25509004,25509245-25509326,25509453-255096... 33 0.099 08_01_0353 - 3107628-3107774,3108177-3108213,3108248-3109164,310... 32 0.13 11_06_0767 + 27121761-27123335,27123701-27123910,27124843-271249... 31 0.30 01_01_0509 - 3713109-3713244,3713689-3713733,3713959-3714015,371... 31 0.30 06_03_1515 - 30707600-30707613,30708093-30708167,30708596-307086... 31 0.40 01_06_1636 - 38800814-38800918,38801024-38801169,38801276-388013... 31 0.40 07_03_1500 + 27001842-27002058,27002144-27002283,27002458-270025... 30 0.53 01_05_0292 + 20518668-20519090,20519213-20519281,20520204-205204... 30 0.69 07_02_0023 - 11918735-11918827,11919139-11919231,11919320-119194... 29 1.2 03_06_0344 - 33276366-33276548,33277044-33277169,33277254-332773... 29 1.2 03_02_0071 + 5425722-5427154,5427259-5427464,5428445-5428686,542... 28 2.8 01_01_0602 - 4484972-4485450,4485949-4485997,4486108-4486237,448... 27 6.5 >01_05_0295 + 20537147-20537291,20539111-20539283,20539365-20539596, 20539743-20539861,20540480-20540536,20540615-20540799, 20542252-20542396,20542463-20542546,20542634-20542697, 20542799-20542809 Length = 404 Score = 62.5 bits (145), Expect = 1e-10 Identities = 25/30 (83%), Positives = 29/30 (96%) Frame = +3 Query: 288 PSEVQHECIPQAVLGMDILCQAKSGMGKTA 377 P +VQHECIPQA+LGMD++CQAKSGMGKTA Sbjct: 46 PPKVQHECIPQAILGMDVICQAKSGMGKTA 75 >01_05_0296 + 20567259-20567386,20568895-20569123,20569205-20569436, 20569583-20569701,20570321-20570377,20570455-20570639, 20571416-20571560,20571630-20571713,20571798-20571861, 20571889-20571932 Length = 428 Score = 59.7 bits (138), Expect = 8e-10 Identities = 24/27 (88%), Positives = 27/27 (100%) Frame = +3 Query: 297 VQHECIPQAVLGMDILCQAKSGMGKTA 377 VQHECIPQA+LGMD++CQAKSGMGKTA Sbjct: 62 VQHECIPQAILGMDVICQAKSGMGKTA 88 >10_08_0553 - 18720436-18720494,18721102-18721106,18721136-18721257, 18721390-18721478,18722136-18722316,18722403-18722654, 18722755-18722993,18723680-18723914,18724072-18724132, 18724632-18724987 Length = 532 Score = 48.4 bits (110), Expect = 2e-06 Identities = 22/38 (57%), Positives = 27/38 (71%) Frame = +3 Query: 264 IVDXGFEHPSEVQHECIPQAVLGMDILCQAKSGMGKTA 377 I + GFE PS +Q E IP A+ G DIL +AK+G GKTA Sbjct: 162 IYEKGFERPSPIQEESIPIALTGSDILARAKNGTGKTA 199 >04_04_0613 + 26617677-26617963,26618726-26618786,26619598-26619832, 26619958-26620196,26620493-26620744,26620844-26621024, 26621810-26621898,26622200-26622273,26622365-26622443 Length = 498 Score = 48.4 bits (110), Expect = 2e-06 Identities = 22/38 (57%), Positives = 27/38 (71%) Frame = +3 Query: 264 IVDXGFEHPSEVQHECIPQAVLGMDILCQAKSGMGKTA 377 I + GFE PS +Q E IP A+ G DIL +AK+G GKTA Sbjct: 139 IYEKGFERPSPIQEESIPIALTGSDILARAKNGTGKTA 176 >02_05_0096 + 25785995-25786311,25786716-25786776,25787825-25788059, 25788292-25788530,25789700-25789951,25790043-25790223, 25790864-25790952,25791269-25791342,25791481-25791584, 25791919-25791957,25792324-25792436 Length = 567 Score = 48.4 bits (110), Expect = 2e-06 Identities = 22/38 (57%), Positives = 27/38 (71%) Frame = +3 Query: 264 IVDXGFEHPSEVQHECIPQAVLGMDILCQAKSGMGKTA 377 I + GFE PS +Q E IP A+ G DIL +AK+G GKTA Sbjct: 149 IYEKGFERPSPIQEESIPIALTGSDILARAKNGTGKTA 186 >07_03_1392 - 26238885-26239007,26239137-26239235,26239636-26239720, 26239825-26240028,26240360-26240682,26241904-26242575 Length = 501 Score = 38.3 bits (85), Expect = 0.002 Identities = 17/34 (50%), Positives = 23/34 (67%) Frame = +3 Query: 276 GFEHPSEVQHECIPQAVLGMDILCQAKSGMGKTA 377 G P+ VQ CIP+A+ G D+L A++G GKTA Sbjct: 96 GMRVPTAVQRRCIPRALEGRDVLGIAETGSGKTA 129 >06_03_0337 + 19678152-19678484,19678616-19678801,19679232-19679417, 19680840-19680926,19681045-19681086,19681164-19681253, 19681399-19681503,19681797-19681835,19681914-19682018, 19682463-19682531,19682587-19682736,19683156-19683335 Length = 523 Score = 38.3 bits (85), Expect = 0.002 Identities = 16/37 (43%), Positives = 23/37 (62%) Frame = +3 Query: 264 IVDXGFEHPSEVQHECIPQAVLGMDILCQAKSGMGKT 374 I D + H +E+Q IP +LG D++ AK+G GKT Sbjct: 101 IRDMNYTHLTEIQARSIPPLMLGSDVMASAKTGSGKT 137 >03_05_0052 - 20293197-20293310,20293938-20294024,20294133-20294270, 20295009-20295128,20295236-20295343,20296053-20296133, 20296216-20296456,20297010-20297305 Length = 394 Score = 38.3 bits (85), Expect = 0.002 Identities = 15/34 (44%), Positives = 22/34 (64%) Frame = +3 Query: 276 GFEHPSEVQHECIPQAVLGMDILCQAKSGMGKTA 377 GFE PS +Q + + G D++ QA+SG GKT+ Sbjct: 50 GFEKPSAIQQRAVLPIISGRDVIAQAQSGTGKTS 83 >01_06_0020 + 25630728-25631023,25631308-25631548,25631629-25631709, 25632109-25632216,25632329-25632448,25632806-25632943, 25633064-25633150,25633802-25633915 Length = 394 Score = 38.3 bits (85), Expect = 0.002 Identities = 15/34 (44%), Positives = 22/34 (64%) Frame = +3 Query: 276 GFEHPSEVQHECIPQAVLGMDILCQAKSGMGKTA 377 GFE PS +Q + + G D++ QA+SG GKT+ Sbjct: 50 GFEKPSAIQQRAVLPIISGRDVIAQAQSGTGKTS 83 >01_05_0721 + 24594815-24594834,24595207-24595313,24595417-24595472, 24595562-24595810,24595871-24596077,24596157-24596243, 24596331-24596426,24596500-24596715,24596908-24597090, 24597222-24597449 Length = 482 Score = 37.5 bits (83), Expect = 0.003 Identities = 15/37 (40%), Positives = 24/37 (64%) Frame = +3 Query: 264 IVDXGFEHPSEVQHECIPQAVLGMDILCQAKSGMGKT 374 + D G+E ++VQ +P + G D+L +AK+G GKT Sbjct: 21 VKDAGYERMTQVQEATLPVILQGKDVLAKAKTGTGKT 57 >12_02_0340 - 17725866-17725884,17726046-17726326,17726842-17726928, 17727018-17727113,17728484-17728585,17728720-17728762, 17728834-17728952,17729348-17729444,17730153-17730214, 17730370-17730432,17730847-17730949,17731402-17731497, 17731594-17731742,17732356-17732529,17733078-17733156, 17733807-17733913,17733994-17734062,17734879-17735043, 17735206-17735703 Length = 802 Score = 37.1 bits (82), Expect = 0.005 Identities = 16/34 (47%), Positives = 22/34 (64%) Frame = +3 Query: 276 GFEHPSEVQHECIPQAVLGMDILCQAKSGMGKTA 377 G++ P+ +Q CIP A+ G DI A +G GKTA Sbjct: 213 GYQKPTPIQAACIPLALTGRDICGSAITGSGKTA 246 >06_03_1284 - 28988287-28988922,28989335-28989765,28989850-28989956, 28990066-28990136 Length = 414 Score = 37.1 bits (82), Expect = 0.005 Identities = 17/34 (50%), Positives = 22/34 (64%) Frame = +3 Query: 276 GFEHPSEVQHECIPQAVLGMDILCQAKSGMGKTA 377 GFE PS +Q I G+D++ QA+SG GKTA Sbjct: 60 GFEKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTA 93 >02_01_0355 + 2558792-2558862,2558993-2559099,2559185-2559615, 2560100-2560735 Length = 414 Score = 37.1 bits (82), Expect = 0.005 Identities = 17/34 (50%), Positives = 22/34 (64%) Frame = +3 Query: 276 GFEHPSEVQHECIPQAVLGMDILCQAKSGMGKTA 377 GFE PS +Q I G+D++ QA+SG GKTA Sbjct: 60 GFEKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTA 93 >01_05_0722 + 24598426-24598649,24599113-24599219,24599319-24599374, 24599469-24599675,24599757-24599963,24600037-24600123, 24600167-24600208,24600209-24600304,24600406-24600621, 24600693-24600875,24601014-24601241 Length = 550 Score = 36.7 bits (81), Expect = 0.006 Identities = 16/37 (43%), Positives = 24/37 (64%) Frame = +3 Query: 264 IVDXGFEHPSEVQHECIPQAVLGMDILCQAKSGMGKT 374 I D G+E ++VQ +P + G D+L +AK+G GKT Sbjct: 89 IKDAGYEKMTQVQEATLPIILQGEDVLAKAKTGTGKT 125 >07_03_0601 - 19872780-19873099,19873148-19873151,19874196-19874357, 19874429-19874617,19874687-19875010,19875103-19875378, 19875436-19875478,19876110-19876188,19876473-19876555, 19876708-19876782,19877324-19877490,19877960-19878370 Length = 710 Score = 36.3 bits (80), Expect = 0.008 Identities = 15/33 (45%), Positives = 21/33 (63%) Frame = +3 Query: 276 GFEHPSEVQHECIPQAVLGMDILCQAKSGMGKT 374 G+ SE+Q +P A+ G D+L AK+G GKT Sbjct: 99 GYTEMSEIQRAALPHALCGRDVLGAAKTGSGKT 131 >03_02_0758 + 10954268-10954841,10955988-10957145,10957176-10957216, 10957412-10957448,10957534-10957954,10958201-10958234 Length = 754 Score = 36.3 bits (80), Expect = 0.008 Identities = 16/38 (42%), Positives = 24/38 (63%) Frame = +3 Query: 264 IVDXGFEHPSEVQHECIPQAVLGMDILCQAKSGMGKTA 377 I G+E P+ +Q + +P + G DI+ AK+G GKTA Sbjct: 234 IAKQGYEKPTTIQCQALPIVLSGRDIIGIAKTGSGKTA 271 >06_03_0674 + 23422004-23422552,23423295-23423369,23424360-23424443, 23424749-23424991,23425348-23425515,23425608-23425727, 23426372-23427016 Length = 627 Score = 35.5 bits (78), Expect = 0.014 Identities = 15/34 (44%), Positives = 23/34 (67%) Frame = +3 Query: 276 GFEHPSEVQHECIPQAVLGMDILCQAKSGMGKTA 377 G+E P+ VQ +P A+ G D++ A++G GKTA Sbjct: 103 GYESPTPVQRYSMPIALAGRDLMACAQTGSGKTA 136 >02_05_1293 - 35520733-35520963,35521696-35521878,35522040-35522255, 35522936-35523022,35523125-35523331,35523426-35523650, 35523743-35523798,35524009-35524115,35524443-35525470 Length = 779 Score = 34.7 bits (76), Expect = 0.024 Identities = 14/38 (36%), Positives = 23/38 (60%) Frame = +3 Query: 264 IVDXGFEHPSEVQHECIPQAVLGMDILCQAKSGMGKTA 377 + D G+ + VQ +P + G D+L +AK+G GK+A Sbjct: 357 LTDAGYVQTTVVQETALPMCLEGKDVLVKAKTGTGKSA 394 >05_01_0079 + 531617-531734,531987-532059,532152-532261,532400-532543, 532628-532736,532836-533182,533260-533333,533478-533782, 534168-534294,534385-534414,534589-534837 Length = 561 Score = 34.3 bits (75), Expect = 0.032 Identities = 14/33 (42%), Positives = 22/33 (66%) Frame = +3 Query: 276 GFEHPSEVQHECIPQAVLGMDILCQAKSGMGKT 374 GF+ P+ +Q + IP A+ G +L +A +G GKT Sbjct: 43 GFQAPTRIQAQAIPVAMSGQHMLVKAATGTGKT 75 >03_05_0997 + 29565311-29565664,29566134-29566298,29566572-29566661, 29566763-29566891,29568141-29568272,29568904-29568969, 29569326-29569505,29569664-29569693,29569744-29569839, 29569959-29570096,29571060-29571142,29571447-29571484, 29571568-29571788,29572491-29572538 Length = 589 Score = 33.1 bits (72), Expect = 0.075 Identities = 13/33 (39%), Positives = 21/33 (63%) Frame = +3 Query: 276 GFEHPSEVQHECIPQAVLGMDILCQAKSGMGKT 374 G + + +Q E IP + G D++ +AK+G GKT Sbjct: 102 GLDKATPIQREAIPLILEGKDVVAKAKTGSGKT 134 >01_07_0333 - 42813789-42814073,42814229-42814315,42815083-42815172, 42815555-42815623,42815859-42815888,42816060-42816164, 42816454-42816549,42816647-42816760,42816862-42816955, 42817027-42817190 Length = 377 Score = 33.1 bits (72), Expect = 0.075 Identities = 13/35 (37%), Positives = 22/35 (62%) Frame = +3 Query: 270 DXGFEHPSEVQHECIPQAVLGMDILCQAKSGMGKT 374 + G+ P+EVQ + +P + G D + A++G GKT Sbjct: 58 EVGYVVPTEVQEQSLPVLLSGQDCILHAQTGSGKT 92 >09_03_0167 + 12965030-12965356,12966100-12966387,12966704-12966826, 12967229-12967611,12967863-12968190,12968324-12968353, 12968837-12968989,12969510-12969815 Length = 645 Score = 32.7 bits (71), Expect = 0.099 Identities = 14/33 (42%), Positives = 19/33 (57%) Frame = +3 Query: 276 GFEHPSEVQHECIPQAVLGMDILCQAKSGMGKT 374 G PS VQ CIP + D++ A++G GKT Sbjct: 101 GLARPSLVQAACIPHVLTTNDVIVAAETGSGKT 133 >08_01_0397 - 3509186-3510291,3510322-3512335 Length = 1039 Score = 32.7 bits (71), Expect = 0.099 Identities = 14/33 (42%), Positives = 20/33 (60%) Frame = +3 Query: 276 GFEHPSEVQHECIPQAVLGMDILCQAKSGMGKT 374 GFE P +Q + +P + G D + AK+G GKT Sbjct: 443 GFEKPMSIQAQALPIIMSGRDCIGIAKTGSGKT 475 >04_04_0476 - 25508952-25509004,25509245-25509326,25509453-25509611, 25509702-25509767,25509898-25510067,25510172-25510262, 25510331-25510410,25510887-25511003,25511092-25511218, 25511685-25511865,25511978-25512366,25512959-25513135, 25513306-25513500,25513844-25514031,25514192-25514500, 25514592-25514637 Length = 809 Score = 32.7 bits (71), Expect = 0.099 Identities = 14/34 (41%), Positives = 21/34 (61%), Gaps = 1/34 (2%) Frame = +3 Query: 276 GFEHPSEVQHECIPQAV-LGMDILCQAKSGMGKT 374 GF+ P+ +Q C P A G D++ A++G GKT Sbjct: 161 GFKEPTPIQKACFPAAAHQGKDVIGAAETGSGKT 194 >08_01_0353 - 3107628-3107774,3108177-3108213,3108248-3109164, 3109210-3110952 Length = 947 Score = 32.3 bits (70), Expect = 0.13 Identities = 14/33 (42%), Positives = 20/33 (60%) Frame = +3 Query: 276 GFEHPSEVQHECIPQAVLGMDILCQAKSGMGKT 374 GFE P +Q + +P + G D + AK+G GKT Sbjct: 304 GFEKPMPIQAQALPIIMSGRDCIGIAKTGSGKT 336 >11_06_0767 + 27121761-27123335,27123701-27123910,27124843-27124911, 27125387-27125656,27126027-27126377,27126480-27126757, 27126887-27128330 Length = 1398 Score = 31.1 bits (67), Expect = 0.30 Identities = 14/33 (42%), Positives = 21/33 (63%) Frame = +3 Query: 276 GFEHPSEVQHECIPQAVLGMDILCQAKSGMGKT 374 GF +P+ +Q + P A+ DI+ AK+G GKT Sbjct: 623 GFLNPTPIQAQTWPVALQNRDIVAIAKTGSGKT 655 >01_01_0509 - 3713109-3713244,3713689-3713733,3713959-3714015, 3714088-3714438,3714585-3714862,3714939-3715289, 3715378-3715647,3716035-3716103,3716194-3716304, 3716503-3716583,3716825-3716914,3717032-3717262 Length = 689 Score = 31.1 bits (67), Expect = 0.30 Identities = 14/33 (42%), Positives = 20/33 (60%) Frame = +3 Query: 276 GFEHPSEVQHECIPQAVLGMDILCQAKSGMGKT 374 GF P+ +Q + P A+ DI+ AK+G GKT Sbjct: 199 GFSAPTPIQAQSWPIALRNRDIVAVAKTGSGKT 231 >06_03_1515 - 30707600-30707613,30708093-30708167,30708596-30708647, 30708751-30708831,30709145-30709219,30709870-30709977, 30710026-30710032,30710133-30710268,30710361-30710685 Length = 290 Score = 30.7 bits (66), Expect = 0.40 Identities = 11/24 (45%), Positives = 19/24 (79%) Frame = +3 Query: 291 SEVQHECIPQAVLGMDILCQAKSG 362 S+++H C+PQ VLG D+ C+ ++G Sbjct: 217 SDIEHGCLPQVVLG-DVPCKFRNG 239 >01_06_1636 - 38800814-38800918,38801024-38801169,38801276-38801381, 38801609-38801686,38801786-38801839,38801920-38801992, 38802059-38802183,38802268-38802357,38802447-38802526, 38802869-38802995,38803145-38803227,38803575-38803710 Length = 400 Score = 30.7 bits (66), Expect = 0.40 Identities = 12/28 (42%), Positives = 18/28 (64%) Frame = +3 Query: 288 PSEVQHECIPQAVLGMDILCQAKSGMGK 371 P EV +C+P A + +DILC ++ GK Sbjct: 197 PKEVSAKCLPDAGIFLDILCSSEDLSGK 224 >07_03_1500 + 27001842-27002058,27002144-27002283,27002458-27002549, 27002680-27002776,27002871-27002951,27003031-27003263, 27003876-27004070,27004149-27004239,27004324-27004446, 27004542-27004692,27005060-27005262 Length = 540 Score = 30.3 bits (65), Expect = 0.53 Identities = 12/33 (36%), Positives = 19/33 (57%) Frame = +3 Query: 276 GFEHPSEVQHECIPQAVLGMDILCQAKSGMGKT 374 GF+ P+ +Q + IP + G + A +G GKT Sbjct: 165 GFQEPTPIQRQAIPILLSGRECFACAPTGSGKT 197 >01_05_0292 + 20518668-20519090,20519213-20519281,20520204-20520473, 20520734-20521084,20521251-20521528,20522755-20523099, 20523346-20523911,20525155-20525528 Length = 891 Score = 29.9 bits (64), Expect = 0.69 Identities = 13/33 (39%), Positives = 20/33 (60%) Frame = +3 Query: 276 GFEHPSEVQHECIPQAVLGMDILCQAKSGMGKT 374 GF P+ +Q + P A+ D++ AK+G GKT Sbjct: 169 GFSSPTPIQAQSWPIALQCQDVVAIAKTGSGKT 201 >07_02_0023 - 11918735-11918827,11919139-11919231,11919320-11919484, 11920234-11920327,11921012-11921136,11921228-11921313, 11921786-11921864,11923777-11923857,11924153-11924260, 11924870-11924994,11925110-11925530 Length = 489 Score = 29.1 bits (62), Expect = 1.2 Identities = 14/33 (42%), Positives = 18/33 (54%) Frame = +3 Query: 276 GFEHPSEVQHECIPQAVLGMDILCQAKSGMGKT 374 GFE PS +Q P + G D + A +G GKT Sbjct: 111 GFERPSPIQAYAWPYLLDGRDFIGIAATGSGKT 143 >03_06_0344 - 33276366-33276548,33277044-33277169,33277254-33277322, 33277401-33277505,33277595-33277633,33277717-33278016, 33278093-33278182,33278271-33278312,33278433-33278516, 33278762-33278947,33279218-33279403,33279663-33280025 Length = 590 Score = 29.1 bits (62), Expect = 1.2 Identities = 12/37 (32%), Positives = 22/37 (59%) Frame = +3 Query: 264 IVDXGFEHPSEVQHECIPQAVLGMDILCQAKSGMGKT 374 I + + + +++Q IP + G D++ AK+G GKT Sbjct: 111 IREMNYTYLTQIQARSIPHLLNGKDVMGAAKTGSGKT 147 >03_02_0071 + 5425722-5427154,5427259-5427464,5428445-5428686, 5428788-5429570 Length = 887 Score = 27.9 bits (59), Expect = 2.8 Identities = 11/38 (28%), Positives = 19/38 (50%) Frame = +2 Query: 116 STTKMKNKQINRLLTGLPKWRQRRRLKDPTYPSTVLVL 229 ST +++ R G+P +RQ R+ DP + +L Sbjct: 492 STPAAPPREVGRKAAGVPSFRQEERVLDPKKAQNIAIL 529 >01_01_0602 - 4484972-4485450,4485949-4485997,4486108-4486237, 4486636-4486778,4486819-4486877,4487167-4487200, 4487489-4487629,4487719-4487907,4488027-4488122, 4488163-4488225,4488588-4489097 Length = 630 Score = 26.6 bits (56), Expect = 6.5 Identities = 10/35 (28%), Positives = 19/35 (54%) Frame = +3 Query: 270 DXGFEHPSEVQHECIPQAVLGMDILCQAKSGMGKT 374 + G P+E+Q +P + G ++ + +G GKT Sbjct: 127 EMGISKPTEIQCVGVPAVLAGTSVVLGSHTGSGKT 161 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 8,514,498 Number of Sequences: 37544 Number of extensions: 126807 Number of successful extensions: 292 Number of sequences better than 10.0: 35 Number of HSP's better than 10.0 without gapping: 290 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 292 length of database: 14,793,348 effective HSP length: 74 effective length of database: 12,015,092 effective search space used: 612769692 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -