BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbS20212 (378 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_48046| Best HMM Match : DEAD (HMM E-Value=4e-38) 82 2e-16 SB_28853| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 2e-16 SB_17563| Best HMM Match : DEAD (HMM E-Value=0) 47 4e-06 SB_2247| Best HMM Match : DEAD (HMM E-Value=0) 47 4e-06 SB_32980| Best HMM Match : DEAD (HMM E-Value=0) 42 1e-04 SB_52411| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 7e-04 SB_51015| Best HMM Match : DEAD (HMM E-Value=0.0057) 38 0.002 SB_9558| Best HMM Match : DEAD (HMM E-Value=0) 37 0.005 SB_52320| Best HMM Match : DEAD (HMM E-Value=0) 37 0.005 SB_11691| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.008 SB_16431| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.044 SB_45898| Best HMM Match : DEAD (HMM E-Value=1.3e-36) 33 0.077 SB_57459| Best HMM Match : DEAD (HMM E-Value=1.50001e-40) 33 0.077 SB_39745| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.7 SB_34907| Best HMM Match : Cadherin (HMM E-Value=0) 27 5.1 SB_59115| Best HMM Match : Spectrin (HMM E-Value=0) 27 6.7 SB_34731| Best HMM Match : DEAD (HMM E-Value=3.8e-31) 26 8.8 SB_13635| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 8.8 SB_57625| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 8.8 SB_43842| Best HMM Match : RNB (HMM E-Value=0) 26 8.8 SB_7920| Best HMM Match : Sec15 (HMM E-Value=2.3) 26 8.8 >SB_48046| Best HMM Match : DEAD (HMM E-Value=4e-38) Length = 475 Score = 81.8 bits (193), Expect = 2e-16 Identities = 35/38 (92%), Positives = 37/38 (97%) Frame = +3 Query: 264 IVDXGFEHPSEVQHECIPQAVLGMDILCQAKSGMGKTA 377 IVD GFEHPSEVQHECIPQA+LGMDI+CQAKSGMGKTA Sbjct: 62 IVDCGFEHPSEVQHECIPQAILGMDIICQAKSGMGKTA 99 Score = 51.2 bits (117), Expect = 3e-07 Identities = 22/24 (91%), Positives = 24/24 (100%) Frame = +1 Query: 181 KKEVKGSYVSIHSSGFRDFLLKPE 252 KK+VKG+YVSIHSSGFRDFLLKPE Sbjct: 34 KKDVKGTYVSIHSSGFRDFLLKPE 57 >SB_28853| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 208 Score = 81.8 bits (193), Expect = 2e-16 Identities = 35/38 (92%), Positives = 37/38 (97%) Frame = +3 Query: 264 IVDXGFEHPSEVQHECIPQAVLGMDILCQAKSGMGKTA 377 IVD GFEHPSEVQHECIPQA+LGMDI+CQAKSGMGKTA Sbjct: 62 IVDCGFEHPSEVQHECIPQAILGMDIICQAKSGMGKTA 99 Score = 51.2 bits (117), Expect = 3e-07 Identities = 22/24 (91%), Positives = 24/24 (100%) Frame = +1 Query: 181 KKEVKGSYVSIHSSGFRDFLLKPE 252 KK+VKG+YVSIHSSGFRDFLLKPE Sbjct: 34 KKDVKGTYVSIHSSGFRDFLLKPE 57 >SB_17563| Best HMM Match : DEAD (HMM E-Value=0) Length = 439 Score = 47.2 bits (107), Expect = 4e-06 Identities = 21/38 (55%), Positives = 27/38 (71%) Frame = +3 Query: 264 IVDXGFEHPSEVQHECIPQAVLGMDILCQAKSGMGKTA 377 I + GF+ PS +Q E IP A+ G DIL +AK+G GKTA Sbjct: 62 IFEKGFDKPSPIQEESIPVALAGRDILARAKNGTGKTA 99 >SB_2247| Best HMM Match : DEAD (HMM E-Value=0) Length = 439 Score = 47.2 bits (107), Expect = 4e-06 Identities = 21/38 (55%), Positives = 27/38 (71%) Frame = +3 Query: 264 IVDXGFEHPSEVQHECIPQAVLGMDILCQAKSGMGKTA 377 I + GF+ PS +Q E IP A+ G DIL +AK+G GKTA Sbjct: 62 IFEKGFDKPSPIQEESIPVALAGRDILARAKNGTGKTA 99 >SB_32980| Best HMM Match : DEAD (HMM E-Value=0) Length = 985 Score = 42.3 bits (95), Expect = 1e-04 Identities = 18/35 (51%), Positives = 24/35 (68%) Frame = +3 Query: 270 DXGFEHPSEVQHECIPQAVLGMDILCQAKSGMGKT 374 + GFE PS +Q + IP G+D++ QAKSG GKT Sbjct: 30 EAGFEKPSPIQLKAIPLGRCGLDLIAQAKSGTGKT 64 >SB_52411| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 370 Score = 39.9 bits (89), Expect = 7e-04 Identities = 17/34 (50%), Positives = 22/34 (64%) Frame = +3 Query: 276 GFEHPSEVQHECIPQAVLGMDILCQAKSGMGKTA 377 GFE PS +Q I + G D++ QA+SG GKTA Sbjct: 16 GFEKPSAIQQRAIKPILKGRDVIAQAQSGTGKTA 49 >SB_51015| Best HMM Match : DEAD (HMM E-Value=0.0057) Length = 96 Score = 38.3 bits (85), Expect = 0.002 Identities = 16/36 (44%), Positives = 23/36 (63%) Frame = +3 Query: 270 DXGFEHPSEVQHECIPQAVLGMDILCQAKSGMGKTA 377 + GF HP+ +Q IP A++G D+ A +G GKTA Sbjct: 27 ELGFLHPTPIQASTIPVALMGKDVCACAATGTGKTA 62 >SB_9558| Best HMM Match : DEAD (HMM E-Value=0) Length = 436 Score = 37.1 bits (82), Expect = 0.005 Identities = 16/37 (43%), Positives = 23/37 (62%) Frame = +3 Query: 267 VDXGFEHPSEVQHECIPQAVLGMDILCQAKSGMGKTA 377 V G + P+E+Q C+P + G D + AK+G GKTA Sbjct: 23 VAMGIKKPTEIQLNCVPPILQGRDCIGCAKTGSGKTA 59 >SB_52320| Best HMM Match : DEAD (HMM E-Value=0) Length = 340 Score = 37.1 bits (82), Expect = 0.005 Identities = 16/37 (43%), Positives = 25/37 (67%) Frame = +3 Query: 264 IVDXGFEHPSEVQHECIPQAVLGMDILCQAKSGMGKT 374 ++ GF P+++Q + IP A+ G D+L AK+G GKT Sbjct: 65 LMKAGFVTPTDIQKQGIPVALSGRDVLGAAKTGSGKT 101 >SB_11691| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1448 Score = 36.3 bits (80), Expect = 0.008 Identities = 17/37 (45%), Positives = 23/37 (62%) Frame = +3 Query: 264 IVDXGFEHPSEVQHECIPQAVLGMDILCQAKSGMGKT 374 I D GF +E+QH+ I + G D+L AK+G GKT Sbjct: 587 IKDMGFTTMTEIQHKSIAPLLKGRDLLGAAKTGSGKT 623 >SB_16431| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 790 Score = 33.9 bits (74), Expect = 0.044 Identities = 14/33 (42%), Positives = 23/33 (69%) Frame = +3 Query: 279 FEHPSEVQHECIPQAVLGMDILCQAKSGMGKTA 377 + P+++Q + +P A+ G DI+ AK+G GKTA Sbjct: 537 YTQPTQIQCQALPIALSGRDIIGIAKTGSGKTA 569 >SB_45898| Best HMM Match : DEAD (HMM E-Value=1.3e-36) Length = 428 Score = 33.1 bits (72), Expect = 0.077 Identities = 16/39 (41%), Positives = 25/39 (64%), Gaps = 1/39 (2%) Frame = +3 Query: 264 IVDX-GFEHPSEVQHECIPQAVLGMDILCQAKSGMGKTA 377 IVD G++ P+ +Q + IP + DI+ A++G GKTA Sbjct: 115 IVDKLGYKDPTPIQRQAIPIGLQNRDIIGVAETGSGKTA 153 >SB_57459| Best HMM Match : DEAD (HMM E-Value=1.50001e-40) Length = 490 Score = 33.1 bits (72), Expect = 0.077 Identities = 14/40 (35%), Positives = 25/40 (62%), Gaps = 2/40 (5%) Frame = +3 Query: 264 IVDXGFEHPSEVQHECIPQAVLG--MDILCQAKSGMGKTA 377 + D GF PS++Q +P + ++++ Q++SG GKTA Sbjct: 118 VYDMGFNKPSKIQETALPMLLADPPVNMIAQSQSGTGKTA 157 >SB_39745| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 996 Score = 28.7 bits (61), Expect = 1.7 Identities = 14/44 (31%), Positives = 22/44 (50%) Frame = +2 Query: 86 SKSWLTTTIFSTTKMKNKQINRLLTGLPKWRQRRRLKDPTYPST 217 +KS T S TK +++ + P W++R R K T P+T Sbjct: 661 TKSARTYLALSRTKRQSRSASTSRIRYPTWKRRNRAKRKTLPAT 704 >SB_34907| Best HMM Match : Cadherin (HMM E-Value=0) Length = 697 Score = 27.1 bits (57), Expect = 5.1 Identities = 16/38 (42%), Positives = 20/38 (52%) Frame = +2 Query: 101 TTTIFSTTKMKNKQINRLLTGLPKWRQRRRLKDPTYPS 214 T+T + TTK Q+N +T P RR LK P PS Sbjct: 651 TSTNYGTTKRATGQVNVEITAKPS--LRRCLKTPHMPS 686 >SB_59115| Best HMM Match : Spectrin (HMM E-Value=0) Length = 1457 Score = 26.6 bits (56), Expect = 6.7 Identities = 10/14 (71%), Positives = 13/14 (92%) Frame = +2 Query: 125 KMKNKQINRLLTGL 166 ++KNK +NRLLTGL Sbjct: 1396 RLKNKNLNRLLTGL 1409 >SB_34731| Best HMM Match : DEAD (HMM E-Value=3.8e-31) Length = 978 Score = 26.2 bits (55), Expect = 8.8 Identities = 10/29 (34%), Positives = 18/29 (62%) Frame = +3 Query: 288 PSEVQHECIPQAVLGMDILCQAKSGMGKT 374 P+ +Q IP+ + ++C A++G GKT Sbjct: 401 PTVIQMVTIPKIIHRHHVICAAQTGSGKT 429 >SB_13635| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 26.2 bits (55), Expect = 8.8 Identities = 12/27 (44%), Positives = 15/27 (55%), Gaps = 2/27 (7%) Frame = +1 Query: 304 TNAFRKPXSVW--TYFAKPSPVWVRQP 378 T KP S+W T +KPS +WV P Sbjct: 26 TTLTSKPSSLWVTTLTSKPSSLWVTSP 52 >SB_57625| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1751 Score = 26.2 bits (55), Expect = 8.8 Identities = 10/27 (37%), Positives = 15/27 (55%) Frame = -1 Query: 375 LSYPYRTWLGKVCPYRXRLAECIRVEL 295 LS P+ W ++ P A C+R+EL Sbjct: 589 LSLPFVAWSVRIFPLAWNTAVCMRIEL 615 >SB_43842| Best HMM Match : RNB (HMM E-Value=0) Length = 1238 Score = 26.2 bits (55), Expect = 8.8 Identities = 11/32 (34%), Positives = 20/32 (62%) Frame = +3 Query: 279 FEHPSEVQHECIPQAVLGMDILCQAKSGMGKT 374 F+ P+ +Q + + + G DI+ A++G GKT Sbjct: 92 FQVPTPIQMQSLSCVMSGRDIIGLAETGSGKT 123 >SB_7920| Best HMM Match : Sec15 (HMM E-Value=2.3) Length = 551 Score = 26.2 bits (55), Expect = 8.8 Identities = 12/24 (50%), Positives = 15/24 (62%) Frame = +2 Query: 104 TTIFSTTKMKNKQINRLLTGLPKW 175 T I S T K++ I+RLL LP W Sbjct: 314 TRIISGTWAKDEDISRLLRTLPNW 337 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 9,996,085 Number of Sequences: 59808 Number of extensions: 151557 Number of successful extensions: 328 Number of sequences better than 10.0: 21 Number of HSP's better than 10.0 without gapping: 312 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 328 length of database: 16,821,457 effective HSP length: 74 effective length of database: 12,395,665 effective search space used: 632178915 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -