BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbS20206 (441 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ441131-7|CAD29636.1| 1977|Anopheles gambiae putative Tyr/Ser/T... 23 3.6 Z49833-1|CAA89994.1| 250|Anopheles gambiae serine proteinase pr... 23 4.8 AF513639-1|AAM53611.1| 195|Anopheles gambiae glutathione S-tran... 23 4.8 DQ990877-1|ABJ90145.1| 105|Anopheles gambiae putative salivary ... 23 6.4 AJ439398-6|CAD28129.1| 1978|Anopheles gambiae putative Tyr/Ser/T... 23 6.4 AY825780-1|AAV70343.1| 147|Anopheles gambiae alanyl-tRNA synthe... 22 8.4 AY825779-1|AAV70342.1| 147|Anopheles gambiae alanyl-tRNA synthe... 22 8.4 AY825778-1|AAV70341.1| 161|Anopheles gambiae alanyl-tRNA synthe... 22 8.4 AY825777-1|AAV70340.1| 161|Anopheles gambiae alanyl-tRNA synthe... 22 8.4 AY825776-1|AAV70339.1| 161|Anopheles gambiae alanyl-tRNA synthe... 22 8.4 AY825775-1|AAV70338.1| 161|Anopheles gambiae alanyl-tRNA synthe... 22 8.4 AY825774-1|AAV70337.1| 160|Anopheles gambiae alanyl-tRNA synthe... 22 8.4 AY825773-1|AAV70336.1| 160|Anopheles gambiae alanyl-tRNA synthe... 22 8.4 AY825772-1|AAV70335.1| 162|Anopheles gambiae alanyl-tRNA synthe... 22 8.4 AY825771-1|AAV70334.1| 162|Anopheles gambiae alanyl-tRNA synthe... 22 8.4 AY825770-1|AAV70333.1| 160|Anopheles gambiae alanyl-tRNA synthe... 22 8.4 AY825769-1|AAV70332.1| 160|Anopheles gambiae alanyl-tRNA synthe... 22 8.4 AY825768-1|AAV70331.1| 160|Anopheles gambiae alanyl-tRNA synthe... 22 8.4 AY825767-1|AAV70330.1| 160|Anopheles gambiae alanyl-tRNA synthe... 22 8.4 AY825766-1|AAV70329.1| 147|Anopheles gambiae alanyl-tRNA synthe... 22 8.4 AY825765-1|AAV70328.1| 147|Anopheles gambiae alanyl-tRNA synthe... 22 8.4 AY825764-1|AAV70327.1| 160|Anopheles gambiae alanyl-tRNA synthe... 22 8.4 AY825763-1|AAV70326.1| 160|Anopheles gambiae alanyl-tRNA synthe... 22 8.4 AY825762-1|AAV70325.1| 146|Anopheles gambiae alanyl-tRNA synthe... 22 8.4 AY825761-1|AAV70324.1| 146|Anopheles gambiae alanyl-tRNA synthe... 22 8.4 AY825760-1|AAV70323.1| 160|Anopheles gambiae alanyl-tRNA synthe... 22 8.4 AY825759-1|AAV70322.1| 160|Anopheles gambiae alanyl-tRNA synthe... 22 8.4 AY825758-1|AAV70321.1| 160|Anopheles gambiae alanyl-tRNA synthe... 22 8.4 AY825757-1|AAV70320.1| 160|Anopheles gambiae alanyl-tRNA synthe... 22 8.4 AY825756-1|AAV70319.1| 160|Anopheles gambiae alanyl-tRNA synthe... 22 8.4 AY825755-1|AAV70318.1| 160|Anopheles gambiae alanyl-tRNA synthe... 22 8.4 AY825754-1|AAV70317.1| 160|Anopheles gambiae alanyl-tRNA synthe... 22 8.4 AY825753-1|AAV70316.1| 160|Anopheles gambiae alanyl-tRNA synthe... 22 8.4 AY825752-1|AAV70315.1| 144|Anopheles gambiae alanyl-tRNA synthe... 22 8.4 AY825751-1|AAV70314.1| 144|Anopheles gambiae alanyl-tRNA synthe... 22 8.4 AY825750-1|AAV70313.1| 130|Anopheles gambiae alanyl-tRNA synthe... 22 8.4 AY825749-1|AAV70312.1| 130|Anopheles gambiae alanyl-tRNA synthe... 22 8.4 AY825748-1|AAV70311.1| 160|Anopheles gambiae alanyl-tRNA synthe... 22 8.4 AY825747-1|AAV70310.1| 160|Anopheles gambiae alanyl-tRNA synthe... 22 8.4 AY825746-1|AAV70309.1| 160|Anopheles gambiae alanyl-tRNA synthe... 22 8.4 AY825745-1|AAV70308.1| 160|Anopheles gambiae alanyl-tRNA synthe... 22 8.4 AY825744-1|AAV70307.1| 160|Anopheles gambiae alanyl-tRNA synthe... 22 8.4 AY825743-1|AAV70306.1| 160|Anopheles gambiae alanyl-tRNA synthe... 22 8.4 AY825742-1|AAV70305.1| 160|Anopheles gambiae alanyl-tRNA synthe... 22 8.4 AY825741-1|AAV70304.1| 160|Anopheles gambiae alanyl-tRNA synthe... 22 8.4 AY825740-1|AAV70303.1| 161|Anopheles gambiae alanyl-tRNA synthe... 22 8.4 AY825739-1|AAV70302.1| 161|Anopheles gambiae alanyl-tRNA synthe... 22 8.4 AY825738-1|AAV70301.1| 160|Anopheles gambiae alanyl-tRNA synthe... 22 8.4 AY825737-1|AAV70300.1| 160|Anopheles gambiae alanyl-tRNA synthe... 22 8.4 AY825736-1|AAV70299.1| 161|Anopheles gambiae alanyl-tRNA synthe... 22 8.4 AY825735-1|AAV70298.1| 161|Anopheles gambiae alanyl-tRNA synthe... 22 8.4 >AJ441131-7|CAD29636.1| 1977|Anopheles gambiae putative Tyr/Ser/Thr phosphatase protein. Length = 1977 Score = 23.4 bits (48), Expect = 3.6 Identities = 15/48 (31%), Positives = 21/48 (43%) Frame = +1 Query: 58 IMSTEDKQYLKPDNTKGSSDDRIIYGDSTADTFKHHWYLEPSMYESDV 201 +M+ +D D T G SDD GD T + PS+ ES + Sbjct: 971 VMAGDDMMMESVDLTIGGSDDGSFAGDKTHSASPNR-LESPSLNESSL 1017 >Z49833-1|CAA89994.1| 250|Anopheles gambiae serine proteinase protein. Length = 250 Score = 23.0 bits (47), Expect = 4.8 Identities = 9/24 (37%), Positives = 12/24 (50%) Frame = +3 Query: 261 ANEDREALGHSGEVSGYPQLFAWY 332 AN + GH E+ YP + A Y Sbjct: 5 ANNSKIVGGHEAEIGRYPWMVALY 28 >AF513639-1|AAM53611.1| 195|Anopheles gambiae glutathione S-transferase S1-2 protein. Length = 195 Score = 23.0 bits (47), Expect = 4.8 Identities = 9/24 (37%), Positives = 11/24 (45%) Frame = +1 Query: 217 NREYNSVMTLDEEWPPTKTVKPWG 288 N ++ V EEWP K P G Sbjct: 18 NLPFDDVRITREEWPALKPTMPMG 41 >DQ990877-1|ABJ90145.1| 105|Anopheles gambiae putative salivary secreted peptide protein. Length = 105 Score = 22.6 bits (46), Expect = 6.4 Identities = 8/23 (34%), Positives = 15/23 (65%) Frame = +1 Query: 64 STEDKQYLKPDNTKGSSDDRIIY 132 +++D+ LKPDN + + II+ Sbjct: 78 ASKDEAGLKPDNARARQETEIIH 100 >AJ439398-6|CAD28129.1| 1978|Anopheles gambiae putative Tyr/Ser/Thr phosphatase protein. Length = 1978 Score = 22.6 bits (46), Expect = 6.4 Identities = 11/29 (37%), Positives = 14/29 (48%) Frame = +1 Query: 58 IMSTEDKQYLKPDNTKGSSDDRIIYGDST 144 +M+ +D D T G SDD GD T Sbjct: 969 VMAGDDMMMESVDLTIGGSDDGSFAGDKT 997 >AY825780-1|AAV70343.1| 147|Anopheles gambiae alanyl-tRNA synthetase protein. Length = 147 Score = 22.2 bits (45), Expect = 8.4 Identities = 10/22 (45%), Positives = 14/22 (63%) Frame = -2 Query: 284 QGFTVFVGGHSSSSVITLLYSR 219 QGF V V SS ++L+Y+R Sbjct: 50 QGFLVKVNDESSEFNVSLVYNR 71 >AY825779-1|AAV70342.1| 147|Anopheles gambiae alanyl-tRNA synthetase protein. Length = 147 Score = 22.2 bits (45), Expect = 8.4 Identities = 10/22 (45%), Positives = 14/22 (63%) Frame = -2 Query: 284 QGFTVFVGGHSSSSVITLLYSR 219 QGF V V SS ++L+Y+R Sbjct: 50 QGFLVKVNDESSEFNVSLVYNR 71 >AY825778-1|AAV70341.1| 161|Anopheles gambiae alanyl-tRNA synthetase protein. Length = 161 Score = 22.2 bits (45), Expect = 8.4 Identities = 10/22 (45%), Positives = 14/22 (63%) Frame = -2 Query: 284 QGFTVFVGGHSSSSVITLLYSR 219 QGF V V SS ++L+Y+R Sbjct: 64 QGFLVKVNDESSEFNVSLVYNR 85 >AY825777-1|AAV70340.1| 161|Anopheles gambiae alanyl-tRNA synthetase protein. Length = 161 Score = 22.2 bits (45), Expect = 8.4 Identities = 10/22 (45%), Positives = 14/22 (63%) Frame = -2 Query: 284 QGFTVFVGGHSSSSVITLLYSR 219 QGF V V SS ++L+Y+R Sbjct: 64 QGFLVKVNDESSEFNVSLVYNR 85 >AY825776-1|AAV70339.1| 161|Anopheles gambiae alanyl-tRNA synthetase protein. Length = 161 Score = 22.2 bits (45), Expect = 8.4 Identities = 10/22 (45%), Positives = 14/22 (63%) Frame = -2 Query: 284 QGFTVFVGGHSSSSVITLLYSR 219 QGF V V SS ++L+Y+R Sbjct: 64 QGFLVKVNDESSEFNVSLVYNR 85 >AY825775-1|AAV70338.1| 161|Anopheles gambiae alanyl-tRNA synthetase protein. Length = 161 Score = 22.2 bits (45), Expect = 8.4 Identities = 10/22 (45%), Positives = 14/22 (63%) Frame = -2 Query: 284 QGFTVFVGGHSSSSVITLLYSR 219 QGF V V SS ++L+Y+R Sbjct: 64 QGFLVKVNDESSEFNVSLVYNR 85 >AY825774-1|AAV70337.1| 160|Anopheles gambiae alanyl-tRNA synthetase protein. Length = 160 Score = 22.2 bits (45), Expect = 8.4 Identities = 10/22 (45%), Positives = 14/22 (63%) Frame = -2 Query: 284 QGFTVFVGGHSSSSVITLLYSR 219 QGF V V SS ++L+Y+R Sbjct: 64 QGFLVKVNDESSEFNVSLVYNR 85 >AY825773-1|AAV70336.1| 160|Anopheles gambiae alanyl-tRNA synthetase protein. Length = 160 Score = 22.2 bits (45), Expect = 8.4 Identities = 10/22 (45%), Positives = 14/22 (63%) Frame = -2 Query: 284 QGFTVFVGGHSSSSVITLLYSR 219 QGF V V SS ++L+Y+R Sbjct: 64 QGFLVKVNDESSEFNVSLVYNR 85 >AY825772-1|AAV70335.1| 162|Anopheles gambiae alanyl-tRNA synthetase protein. Length = 162 Score = 22.2 bits (45), Expect = 8.4 Identities = 10/22 (45%), Positives = 14/22 (63%) Frame = -2 Query: 284 QGFTVFVGGHSSSSVITLLYSR 219 QGF V V SS ++L+Y+R Sbjct: 64 QGFLVKVNDESSEFNVSLVYNR 85 >AY825771-1|AAV70334.1| 162|Anopheles gambiae alanyl-tRNA synthetase protein. Length = 162 Score = 22.2 bits (45), Expect = 8.4 Identities = 10/22 (45%), Positives = 14/22 (63%) Frame = -2 Query: 284 QGFTVFVGGHSSSSVITLLYSR 219 QGF V V SS ++L+Y+R Sbjct: 64 QGFLVKVNDESSEFNVSLVYNR 85 >AY825770-1|AAV70333.1| 160|Anopheles gambiae alanyl-tRNA synthetase protein. Length = 160 Score = 22.2 bits (45), Expect = 8.4 Identities = 10/22 (45%), Positives = 14/22 (63%) Frame = -2 Query: 284 QGFTVFVGGHSSSSVITLLYSR 219 QGF V V SS ++L+Y+R Sbjct: 64 QGFLVKVNDESSEFNVSLVYNR 85 >AY825769-1|AAV70332.1| 160|Anopheles gambiae alanyl-tRNA synthetase protein. Length = 160 Score = 22.2 bits (45), Expect = 8.4 Identities = 10/22 (45%), Positives = 14/22 (63%) Frame = -2 Query: 284 QGFTVFVGGHSSSSVITLLYSR 219 QGF V V SS ++L+Y+R Sbjct: 64 QGFLVKVNDESSEFNVSLVYNR 85 >AY825768-1|AAV70331.1| 160|Anopheles gambiae alanyl-tRNA synthetase protein. Length = 160 Score = 22.2 bits (45), Expect = 8.4 Identities = 10/22 (45%), Positives = 14/22 (63%) Frame = -2 Query: 284 QGFTVFVGGHSSSSVITLLYSR 219 QGF V V SS ++L+Y+R Sbjct: 64 QGFLVKVNDESSEFNVSLVYNR 85 >AY825767-1|AAV70330.1| 160|Anopheles gambiae alanyl-tRNA synthetase protein. Length = 160 Score = 22.2 bits (45), Expect = 8.4 Identities = 10/22 (45%), Positives = 14/22 (63%) Frame = -2 Query: 284 QGFTVFVGGHSSSSVITLLYSR 219 QGF V V SS ++L+Y+R Sbjct: 64 QGFLVKVNDESSEFNVSLVYNR 85 >AY825766-1|AAV70329.1| 147|Anopheles gambiae alanyl-tRNA synthetase protein. Length = 147 Score = 22.2 bits (45), Expect = 8.4 Identities = 10/22 (45%), Positives = 14/22 (63%) Frame = -2 Query: 284 QGFTVFVGGHSSSSVITLLYSR 219 QGF V V SS ++L+Y+R Sbjct: 51 QGFLVKVNDESSEFNVSLVYNR 72 >AY825765-1|AAV70328.1| 147|Anopheles gambiae alanyl-tRNA synthetase protein. Length = 147 Score = 22.2 bits (45), Expect = 8.4 Identities = 10/22 (45%), Positives = 14/22 (63%) Frame = -2 Query: 284 QGFTVFVGGHSSSSVITLLYSR 219 QGF V V SS ++L+Y+R Sbjct: 51 QGFLVKVNDESSEFNVSLVYNR 72 >AY825764-1|AAV70327.1| 160|Anopheles gambiae alanyl-tRNA synthetase protein. Length = 160 Score = 22.2 bits (45), Expect = 8.4 Identities = 10/22 (45%), Positives = 14/22 (63%) Frame = -2 Query: 284 QGFTVFVGGHSSSSVITLLYSR 219 QGF V V SS ++L+Y+R Sbjct: 64 QGFLVKVNDESSEFNVSLVYNR 85 >AY825763-1|AAV70326.1| 160|Anopheles gambiae alanyl-tRNA synthetase protein. Length = 160 Score = 22.2 bits (45), Expect = 8.4 Identities = 10/22 (45%), Positives = 14/22 (63%) Frame = -2 Query: 284 QGFTVFVGGHSSSSVITLLYSR 219 QGF V V SS ++L+Y+R Sbjct: 64 QGFLVKVNDESSEFNVSLVYNR 85 >AY825762-1|AAV70325.1| 146|Anopheles gambiae alanyl-tRNA synthetase protein. Length = 146 Score = 22.2 bits (45), Expect = 8.4 Identities = 10/22 (45%), Positives = 14/22 (63%) Frame = -2 Query: 284 QGFTVFVGGHSSSSVITLLYSR 219 QGF V V SS ++L+Y+R Sbjct: 50 QGFLVKVNDESSEFNVSLVYNR 71 >AY825761-1|AAV70324.1| 146|Anopheles gambiae alanyl-tRNA synthetase protein. Length = 146 Score = 22.2 bits (45), Expect = 8.4 Identities = 10/22 (45%), Positives = 14/22 (63%) Frame = -2 Query: 284 QGFTVFVGGHSSSSVITLLYSR 219 QGF V V SS ++L+Y+R Sbjct: 50 QGFLVKVNDESSEFNVSLVYNR 71 >AY825760-1|AAV70323.1| 160|Anopheles gambiae alanyl-tRNA synthetase protein. Length = 160 Score = 22.2 bits (45), Expect = 8.4 Identities = 10/22 (45%), Positives = 14/22 (63%) Frame = -2 Query: 284 QGFTVFVGGHSSSSVITLLYSR 219 QGF V V SS ++L+Y+R Sbjct: 64 QGFLVKVNDESSEFNVSLVYNR 85 >AY825759-1|AAV70322.1| 160|Anopheles gambiae alanyl-tRNA synthetase protein. Length = 160 Score = 22.2 bits (45), Expect = 8.4 Identities = 10/22 (45%), Positives = 14/22 (63%) Frame = -2 Query: 284 QGFTVFVGGHSSSSVITLLYSR 219 QGF V V SS ++L+Y+R Sbjct: 64 QGFLVKVNDESSEFNVSLVYNR 85 >AY825758-1|AAV70321.1| 160|Anopheles gambiae alanyl-tRNA synthetase protein. Length = 160 Score = 22.2 bits (45), Expect = 8.4 Identities = 10/22 (45%), Positives = 14/22 (63%) Frame = -2 Query: 284 QGFTVFVGGHSSSSVITLLYSR 219 QGF V V SS ++L+Y+R Sbjct: 64 QGFLVKVNDESSEFNVSLVYNR 85 >AY825757-1|AAV70320.1| 160|Anopheles gambiae alanyl-tRNA synthetase protein. Length = 160 Score = 22.2 bits (45), Expect = 8.4 Identities = 10/22 (45%), Positives = 14/22 (63%) Frame = -2 Query: 284 QGFTVFVGGHSSSSVITLLYSR 219 QGF V V SS ++L+Y+R Sbjct: 64 QGFLVKVNDESSEFNVSLVYNR 85 >AY825756-1|AAV70319.1| 160|Anopheles gambiae alanyl-tRNA synthetase protein. Length = 160 Score = 22.2 bits (45), Expect = 8.4 Identities = 10/22 (45%), Positives = 14/22 (63%) Frame = -2 Query: 284 QGFTVFVGGHSSSSVITLLYSR 219 QGF V V SS ++L+Y+R Sbjct: 64 QGFLVKVNDESSEFNVSLVYNR 85 >AY825755-1|AAV70318.1| 160|Anopheles gambiae alanyl-tRNA synthetase protein. Length = 160 Score = 22.2 bits (45), Expect = 8.4 Identities = 10/22 (45%), Positives = 14/22 (63%) Frame = -2 Query: 284 QGFTVFVGGHSSSSVITLLYSR 219 QGF V V SS ++L+Y+R Sbjct: 64 QGFLVKVNDESSEFNVSLVYNR 85 >AY825754-1|AAV70317.1| 160|Anopheles gambiae alanyl-tRNA synthetase protein. Length = 160 Score = 22.2 bits (45), Expect = 8.4 Identities = 10/22 (45%), Positives = 14/22 (63%) Frame = -2 Query: 284 QGFTVFVGGHSSSSVITLLYSR 219 QGF V V SS ++L+Y+R Sbjct: 64 QGFLVKVNDESSEFNVSLVYNR 85 >AY825753-1|AAV70316.1| 160|Anopheles gambiae alanyl-tRNA synthetase protein. Length = 160 Score = 22.2 bits (45), Expect = 8.4 Identities = 10/22 (45%), Positives = 14/22 (63%) Frame = -2 Query: 284 QGFTVFVGGHSSSSVITLLYSR 219 QGF V V SS ++L+Y+R Sbjct: 64 QGFLVKVNDESSEFNVSLVYNR 85 >AY825752-1|AAV70315.1| 144|Anopheles gambiae alanyl-tRNA synthetase protein. Length = 144 Score = 22.2 bits (45), Expect = 8.4 Identities = 10/22 (45%), Positives = 14/22 (63%) Frame = -2 Query: 284 QGFTVFVGGHSSSSVITLLYSR 219 QGF V V SS ++L+Y+R Sbjct: 64 QGFLVKVNDESSEFNVSLVYNR 85 >AY825751-1|AAV70314.1| 144|Anopheles gambiae alanyl-tRNA synthetase protein. Length = 144 Score = 22.2 bits (45), Expect = 8.4 Identities = 10/22 (45%), Positives = 14/22 (63%) Frame = -2 Query: 284 QGFTVFVGGHSSSSVITLLYSR 219 QGF V V SS ++L+Y+R Sbjct: 64 QGFLVKVNDESSEFNVSLVYNR 85 >AY825750-1|AAV70313.1| 130|Anopheles gambiae alanyl-tRNA synthetase protein. Length = 130 Score = 22.2 bits (45), Expect = 8.4 Identities = 10/22 (45%), Positives = 14/22 (63%) Frame = -2 Query: 284 QGFTVFVGGHSSSSVITLLYSR 219 QGF V V SS ++L+Y+R Sbjct: 34 QGFLVKVNDESSEFNVSLVYNR 55 >AY825749-1|AAV70312.1| 130|Anopheles gambiae alanyl-tRNA synthetase protein. Length = 130 Score = 22.2 bits (45), Expect = 8.4 Identities = 10/22 (45%), Positives = 14/22 (63%) Frame = -2 Query: 284 QGFTVFVGGHSSSSVITLLYSR 219 QGF V V SS ++L+Y+R Sbjct: 34 QGFLVKVNDESSEFNVSLVYNR 55 >AY825748-1|AAV70311.1| 160|Anopheles gambiae alanyl-tRNA synthetase protein. Length = 160 Score = 22.2 bits (45), Expect = 8.4 Identities = 10/22 (45%), Positives = 14/22 (63%) Frame = -2 Query: 284 QGFTVFVGGHSSSSVITLLYSR 219 QGF V V SS ++L+Y+R Sbjct: 64 QGFLVKVNDESSEFNVSLVYNR 85 >AY825747-1|AAV70310.1| 160|Anopheles gambiae alanyl-tRNA synthetase protein. Length = 160 Score = 22.2 bits (45), Expect = 8.4 Identities = 10/22 (45%), Positives = 14/22 (63%) Frame = -2 Query: 284 QGFTVFVGGHSSSSVITLLYSR 219 QGF V V SS ++L+Y+R Sbjct: 64 QGFLVKVNDESSEFNVSLVYNR 85 >AY825746-1|AAV70309.1| 160|Anopheles gambiae alanyl-tRNA synthetase protein. Length = 160 Score = 22.2 bits (45), Expect = 8.4 Identities = 10/22 (45%), Positives = 14/22 (63%) Frame = -2 Query: 284 QGFTVFVGGHSSSSVITLLYSR 219 QGF V V SS ++L+Y+R Sbjct: 64 QGFLVKVNDESSEFNVSLVYNR 85 >AY825745-1|AAV70308.1| 160|Anopheles gambiae alanyl-tRNA synthetase protein. Length = 160 Score = 22.2 bits (45), Expect = 8.4 Identities = 10/22 (45%), Positives = 14/22 (63%) Frame = -2 Query: 284 QGFTVFVGGHSSSSVITLLYSR 219 QGF V V SS ++L+Y+R Sbjct: 64 QGFLVKVNDESSEFNVSLVYNR 85 >AY825744-1|AAV70307.1| 160|Anopheles gambiae alanyl-tRNA synthetase protein. Length = 160 Score = 22.2 bits (45), Expect = 8.4 Identities = 10/22 (45%), Positives = 14/22 (63%) Frame = -2 Query: 284 QGFTVFVGGHSSSSVITLLYSR 219 QGF V V SS ++L+Y+R Sbjct: 64 QGFLVKVNDESSEFNVSLVYNR 85 >AY825743-1|AAV70306.1| 160|Anopheles gambiae alanyl-tRNA synthetase protein. Length = 160 Score = 22.2 bits (45), Expect = 8.4 Identities = 10/22 (45%), Positives = 14/22 (63%) Frame = -2 Query: 284 QGFTVFVGGHSSSSVITLLYSR 219 QGF V V SS ++L+Y+R Sbjct: 64 QGFLVKVNDESSEFNVSLVYNR 85 >AY825742-1|AAV70305.1| 160|Anopheles gambiae alanyl-tRNA synthetase protein. Length = 160 Score = 22.2 bits (45), Expect = 8.4 Identities = 10/22 (45%), Positives = 14/22 (63%) Frame = -2 Query: 284 QGFTVFVGGHSSSSVITLLYSR 219 QGF V V SS ++L+Y+R Sbjct: 64 QGFLVKVNDESSEFNVSLVYNR 85 >AY825741-1|AAV70304.1| 160|Anopheles gambiae alanyl-tRNA synthetase protein. Length = 160 Score = 22.2 bits (45), Expect = 8.4 Identities = 10/22 (45%), Positives = 14/22 (63%) Frame = -2 Query: 284 QGFTVFVGGHSSSSVITLLYSR 219 QGF V V SS ++L+Y+R Sbjct: 64 QGFLVKVNDESSEFNVSLVYNR 85 >AY825740-1|AAV70303.1| 161|Anopheles gambiae alanyl-tRNA synthetase protein. Length = 161 Score = 22.2 bits (45), Expect = 8.4 Identities = 10/22 (45%), Positives = 14/22 (63%) Frame = -2 Query: 284 QGFTVFVGGHSSSSVITLLYSR 219 QGF V V SS ++L+Y+R Sbjct: 64 QGFLVKVNDESSEFNVSLVYNR 85 >AY825739-1|AAV70302.1| 161|Anopheles gambiae alanyl-tRNA synthetase protein. Length = 161 Score = 22.2 bits (45), Expect = 8.4 Identities = 10/22 (45%), Positives = 14/22 (63%) Frame = -2 Query: 284 QGFTVFVGGHSSSSVITLLYSR 219 QGF V V SS ++L+Y+R Sbjct: 64 QGFLVKVNDESSEFNVSLVYNR 85 >AY825738-1|AAV70301.1| 160|Anopheles gambiae alanyl-tRNA synthetase protein. Length = 160 Score = 22.2 bits (45), Expect = 8.4 Identities = 10/22 (45%), Positives = 14/22 (63%) Frame = -2 Query: 284 QGFTVFVGGHSSSSVITLLYSR 219 QGF V V SS ++L+Y+R Sbjct: 64 QGFLVKVNDESSEFNVSLVYNR 85 >AY825737-1|AAV70300.1| 160|Anopheles gambiae alanyl-tRNA synthetase protein. Length = 160 Score = 22.2 bits (45), Expect = 8.4 Identities = 10/22 (45%), Positives = 14/22 (63%) Frame = -2 Query: 284 QGFTVFVGGHSSSSVITLLYSR 219 QGF V V SS ++L+Y+R Sbjct: 64 QGFLVKVNDESSEFNVSLVYNR 85 >AY825736-1|AAV70299.1| 161|Anopheles gambiae alanyl-tRNA synthetase protein. Length = 161 Score = 22.2 bits (45), Expect = 8.4 Identities = 10/22 (45%), Positives = 14/22 (63%) Frame = -2 Query: 284 QGFTVFVGGHSSSSVITLLYSR 219 QGF V V SS ++L+Y+R Sbjct: 64 QGFLVKVNDESSEFNVSLVYNR 85 >AY825735-1|AAV70298.1| 161|Anopheles gambiae alanyl-tRNA synthetase protein. Length = 161 Score = 22.2 bits (45), Expect = 8.4 Identities = 10/22 (45%), Positives = 14/22 (63%) Frame = -2 Query: 284 QGFTVFVGGHSSSSVITLLYSR 219 QGF V V SS ++L+Y+R Sbjct: 64 QGFLVKVNDESSEFNVSLVYNR 85 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 417,393 Number of Sequences: 2352 Number of extensions: 8771 Number of successful extensions: 63 Number of sequences better than 10.0: 51 Number of HSP's better than 10.0 without gapping: 63 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 63 length of database: 563,979 effective HSP length: 59 effective length of database: 425,211 effective search space used: 36993357 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -