BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbS20205 (540 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value CR954257-7|CAJ14158.1| 284|Anopheles gambiae signal sequence re... 27 0.30 AB090822-1|BAC57919.1| 468|Anopheles gambiae gag-like protein p... 23 8.7 >CR954257-7|CAJ14158.1| 284|Anopheles gambiae signal sequence receptor protein. Length = 284 Score = 27.5 bits (58), Expect = 0.30 Identities = 12/36 (33%), Positives = 20/36 (55%) Frame = -3 Query: 340 SYSRRRRPTSHRNTSEKHLISIQLINYQLYPIKLTK 233 SY +R+RPT+ R E S + ++Y+ P + K Sbjct: 223 SYGKRKRPTAARKVVETGTASTKDVDYEWIPSETLK 258 >AB090822-1|BAC57919.1| 468|Anopheles gambiae gag-like protein protein. Length = 468 Score = 22.6 bits (46), Expect = 8.7 Identities = 12/36 (33%), Positives = 18/36 (50%), Gaps = 1/36 (2%) Frame = +1 Query: 7 WRKVVRRKKTHWETRXRPRYLTS-QRN*GKPHTDTR 111 WR+V RRK + R R T Q++ +P +R Sbjct: 191 WREVTRRKSRRSDNRRNERESTQYQQSVHQPQQSSR 226 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 485,310 Number of Sequences: 2352 Number of extensions: 8293 Number of successful extensions: 46 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 46 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 46 length of database: 563,979 effective HSP length: 60 effective length of database: 422,859 effective search space used: 50320221 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -