Bombyx BLAST Result against tribolium

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fbS20203
         (508 letters)

Database: tribolium 
           336 sequences; 122,585 total letters

Searching.......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 pro...    25   0.29 
AM292375-1|CAL23187.2|  311|Tribolium castaneum gustatory recept...    21   6.3  

>DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 protein.
          Length = 2700

 Score = 25.4 bits (53), Expect = 0.29
 Identities = 15/48 (31%), Positives = 22/48 (45%)
 Frame = +3

Query: 204  NQGKGSIIQNVVNNLIITEVGTPWSXATSCGSATDSTLSESTSPITLD 347
            NQG+  + Q   N L   +    W   T C     ST++ ST+P+  D
Sbjct: 2256 NQGQLQL-QVCPNGLFWNKDHCDWPENTECHPDASSTMAPSTTPMVPD 2302


>AM292375-1|CAL23187.2|  311|Tribolium castaneum gustatory receptor
           candidate 54 protein.
          Length = 311

 Score = 21.0 bits (42), Expect = 6.3
 Identities = 8/11 (72%), Positives = 8/11 (72%)
 Frame = +2

Query: 260 SRNTMEXCYKL 292
           SR T E CYKL
Sbjct: 239 SRKTAEMCYKL 249


  Database: tribolium
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 122,585
  Number of sequences in database:  336
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 100,700
Number of Sequences: 336
Number of extensions: 1866
Number of successful extensions: 3
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 3
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 3
length of database: 122,585
effective HSP length: 53
effective length of database: 104,777
effective search space used: 12049355
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 40 (21.2 bits)