BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbS20203 (508 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AF159569-1|AAF70859.1| 1124|Apis mellifera period clock protein ... 22 3.2 AB050744-1|BAB17753.1| 238|Apis mellifera period protein protein. 22 3.2 DQ244075-1|ABB36785.1| 548|Apis mellifera cytochrome P450 monoo... 22 4.2 AY686596-1|AAT96374.1| 1946|Apis mellifera Dscam protein. 21 7.3 DQ013068-1|AAY81956.1| 931|Apis mellifera dusty protein kinase ... 21 9.7 DQ013067-1|AAY81955.1| 969|Apis mellifera dusty protein kinase ... 21 9.7 AF000632-1|AAC61894.1| 452|Apis mellifera major royal jelly pro... 21 9.7 >AF159569-1|AAF70859.1| 1124|Apis mellifera period clock protein protein. Length = 1124 Score = 22.2 bits (45), Expect = 3.2 Identities = 12/35 (34%), Positives = 18/35 (51%) Frame = -1 Query: 310 LSVADPQLVAXLHGVPTSVMIRLLTTFWMMEPLPW 206 LS DP +V +P ++ R L F+ E LP+ Sbjct: 320 LSHVDPDVVQYFGYLPQDMVGRSLFDFYHPEDLPF 354 >AB050744-1|BAB17753.1| 238|Apis mellifera period protein protein. Length = 238 Score = 22.2 bits (45), Expect = 3.2 Identities = 12/35 (34%), Positives = 18/35 (51%) Frame = -1 Query: 310 LSVADPQLVAXLHGVPTSVMIRLLTTFWMMEPLPW 206 LS DP +V +P ++ R L F+ E LP+ Sbjct: 26 LSHVDPDVVQYFGYLPQDMVGRSLFDFYHPEDLPF 60 >DQ244075-1|ABB36785.1| 548|Apis mellifera cytochrome P450 monooxygenase protein. Length = 548 Score = 21.8 bits (44), Expect = 4.2 Identities = 9/21 (42%), Positives = 13/21 (61%) Frame = -2 Query: 222 WSPCLGSRIPSSDGQRCRSHR 160 + P LG + S GQ+ R+HR Sbjct: 118 FKPWLGDGLLISTGQKWRNHR 138 >AY686596-1|AAT96374.1| 1946|Apis mellifera Dscam protein. Length = 1946 Score = 21.0 bits (42), Expect = 7.3 Identities = 9/31 (29%), Positives = 15/31 (48%) Frame = +2 Query: 182 PSELGIREPRQGLHHPECS*QPDHYGSRNTM 274 P+ E + G + + DHYGSR ++ Sbjct: 1810 PANCAPEEDQYGSQYGQYGAPYDHYGSRGSV 1840 >DQ013068-1|AAY81956.1| 931|Apis mellifera dusty protein kinase isoform B protein. Length = 931 Score = 20.6 bits (41), Expect = 9.7 Identities = 7/20 (35%), Positives = 13/20 (65%) Frame = +2 Query: 257 GSRNTMEXCYKLWVGNGQHI 316 G + ++E W+G+GQ+I Sbjct: 250 GMKESVEVDQLSWLGSGQYI 269 >DQ013067-1|AAY81955.1| 969|Apis mellifera dusty protein kinase isoform A protein. Length = 969 Score = 20.6 bits (41), Expect = 9.7 Identities = 7/20 (35%), Positives = 13/20 (65%) Frame = +2 Query: 257 GSRNTMEXCYKLWVGNGQHI 316 G + ++E W+G+GQ+I Sbjct: 288 GMKESVEVDQLSWLGSGQYI 307 >AF000632-1|AAC61894.1| 452|Apis mellifera major royal jelly protein MRJP2 protein. Length = 452 Score = 20.6 bits (41), Expect = 9.7 Identities = 8/14 (57%), Positives = 10/14 (71%) Frame = +3 Query: 465 KEQRPHQVGSXLPL 506 KE+ PH VGS P+ Sbjct: 358 KEELPHFVGSNKPV 371 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 127,481 Number of Sequences: 438 Number of extensions: 2405 Number of successful extensions: 7 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 146,343 effective HSP length: 54 effective length of database: 122,691 effective search space used: 13986774 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -