BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbS20202 (590 letters) Database: fruitfly 53,049 sequences; 24,988,368 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value BT023836-1|AAZ86757.1| 1199|Drosophila melanogaster LD18215p pro... 28 8.2 BT011109-1|AAR82776.1| 1190|Drosophila melanogaster LD47325p pro... 28 8.2 AE013599-1009|AAF58849.1| 1199|Drosophila melanogaster CG1371-PA... 28 8.2 >BT023836-1|AAZ86757.1| 1199|Drosophila melanogaster LD18215p protein. Length = 1199 Score = 28.3 bits (60), Expect = 8.2 Identities = 16/40 (40%), Positives = 22/40 (55%) Frame = -3 Query: 345 SRNTTVSKNSCILSGKPVVKAVLSAPPWPTTVPLYLQKKK 226 S NT + NS ++SG VV S+ P P + + L KKK Sbjct: 190 SGNTELPANSLVVSGFDVVGRFDSSSPLPGNLGVALYKKK 229 >BT011109-1|AAR82776.1| 1190|Drosophila melanogaster LD47325p protein. Length = 1190 Score = 28.3 bits (60), Expect = 8.2 Identities = 16/40 (40%), Positives = 22/40 (55%) Frame = -3 Query: 345 SRNTTVSKNSCILSGKPVVKAVLSAPPWPTTVPLYLQKKK 226 S NT + NS ++SG VV S+ P P + + L KKK Sbjct: 181 SGNTELPANSLVVSGFDVVGRFDSSSPLPGNLGVALYKKK 220 >AE013599-1009|AAF58849.1| 1199|Drosophila melanogaster CG1371-PA protein. Length = 1199 Score = 28.3 bits (60), Expect = 8.2 Identities = 16/40 (40%), Positives = 22/40 (55%) Frame = -3 Query: 345 SRNTTVSKNSCILSGKPVVKAVLSAPPWPTTVPLYLQKKK 226 S NT + NS ++SG VV S+ P P + + L KKK Sbjct: 190 SGNTELPANSLVVSGFDVVGRFDSSSPLPGNLGVALYKKK 229 Database: fruitfly Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 24,988,368 Number of sequences in database: 53,049 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 22,897,957 Number of Sequences: 53049 Number of extensions: 444603 Number of successful extensions: 988 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 936 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 988 length of database: 24,988,368 effective HSP length: 81 effective length of database: 20,691,399 effective search space used: 2379510885 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -