BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbS20201 (306 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ325094-1|ABD14108.1| 175|Apis mellifera complementary sex det... 24 0.37 DQ325093-1|ABD14107.1| 175|Apis mellifera complementary sex det... 24 0.37 DQ325092-1|ABD14106.1| 175|Apis mellifera complementary sex det... 24 0.37 DQ325091-1|ABD14105.1| 175|Apis mellifera complementary sex det... 24 0.37 AY569716-1|AAS86669.1| 406|Apis mellifera complementary sex det... 24 0.37 AY569710-1|AAS86663.1| 408|Apis mellifera complementary sex det... 24 0.37 AY569709-1|AAS86662.1| 408|Apis mellifera complementary sex det... 24 0.37 AY569708-1|AAS86661.1| 408|Apis mellifera complementary sex det... 24 0.37 AY569707-1|AAS86660.1| 408|Apis mellifera complementary sex det... 24 0.37 AY569706-1|AAS86659.1| 397|Apis mellifera complementary sex det... 24 0.37 DQ325103-1|ABD14117.1| 182|Apis mellifera complementary sex det... 21 4.5 DQ325083-1|ABD14097.1| 189|Apis mellifera complementary sex det... 21 4.5 AY569720-1|AAS86673.1| 406|Apis mellifera complementary sex det... 21 4.5 AY569717-1|AAS86670.1| 397|Apis mellifera complementary sex det... 21 4.5 AY569712-1|AAS86665.1| 408|Apis mellifera complementary sex det... 21 4.5 AY569703-1|AAS86656.1| 396|Apis mellifera complementary sex det... 21 4.5 AY569701-1|AAS86654.1| 407|Apis mellifera complementary sex det... 21 4.5 AY569700-1|AAS86653.1| 407|Apis mellifera complementary sex det... 21 4.5 AY569699-1|AAS86652.1| 396|Apis mellifera complementary sex det... 21 4.5 AY569697-1|AAS86650.1| 413|Apis mellifera complementary sex det... 21 4.5 AY569694-1|AAS86647.1| 400|Apis mellifera complementary sex det... 21 4.5 AY352277-1|AAQ67418.1| 418|Apis mellifera complementary sex det... 21 4.5 AY352276-1|AAQ67417.1| 385|Apis mellifera complementary sex det... 21 4.5 AY350618-1|AAQ57660.1| 425|Apis mellifera complementary sex det... 21 4.5 AB161182-1|BAD08344.1| 1040|Apis mellifera metabotropic glutamat... 21 4.5 AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. 21 4.5 L10430-1|AAA27731.1| 150|Apis mellifera transposase protein. 20 6.0 Z26318-1|CAA81227.1| 544|Apis mellifera royal jelly protein RJP... 20 7.9 DQ667187-1|ABG75739.1| 428|Apis mellifera histamine-gated chlor... 20 7.9 DQ325133-1|ABD14147.1| 181|Apis mellifera complementary sex det... 20 7.9 DQ325130-1|ABD14144.1| 174|Apis mellifera complementary sex det... 20 7.9 DQ325129-1|ABD14143.1| 174|Apis mellifera complementary sex det... 20 7.9 DQ325128-1|ABD14142.1| 174|Apis mellifera complementary sex det... 20 7.9 DQ325127-1|ABD14141.1| 174|Apis mellifera complementary sex det... 20 7.9 DQ325126-1|ABD14140.1| 174|Apis mellifera complementary sex det... 20 7.9 DQ325125-1|ABD14139.1| 174|Apis mellifera complementary sex det... 20 7.9 DQ325115-1|ABD14129.1| 185|Apis mellifera complementary sex det... 20 7.9 DQ325075-1|ABD14089.1| 181|Apis mellifera complementary sex det... 20 7.9 DQ325074-1|ABD14088.1| 181|Apis mellifera complementary sex det... 20 7.9 DQ325073-1|ABD14087.1| 181|Apis mellifera complementary sex det... 20 7.9 DQ325072-1|ABD14086.1| 181|Apis mellifera complementary sex det... 20 7.9 DQ325071-1|ABD14085.1| 181|Apis mellifera complementary sex det... 20 7.9 DQ325070-1|ABD14084.1| 181|Apis mellifera complementary sex det... 20 7.9 DQ325069-1|ABD14083.1| 181|Apis mellifera complementary sex det... 20 7.9 DQ325068-1|ABD14082.1| 181|Apis mellifera complementary sex det... 20 7.9 AY569698-1|AAS86651.1| 407|Apis mellifera complementary sex det... 20 7.9 AY569696-1|AAS86649.1| 414|Apis mellifera complementary sex det... 20 7.9 AY569695-1|AAS86648.1| 414|Apis mellifera complementary sex det... 20 7.9 >DQ325094-1|ABD14108.1| 175|Apis mellifera complementary sex determiner protein. Length = 175 Score = 24.2 bits (50), Expect = 0.37 Identities = 8/25 (32%), Positives = 14/25 (56%) Frame = +1 Query: 109 YNKDTNAFYKLHTDSAKIWDAKSSC 183 Y K + KLH + K+ + ++SC Sbjct: 12 YRKKDRRYEKLHNEKEKLLEERTSC 36 >DQ325093-1|ABD14107.1| 175|Apis mellifera complementary sex determiner protein. Length = 175 Score = 24.2 bits (50), Expect = 0.37 Identities = 8/25 (32%), Positives = 14/25 (56%) Frame = +1 Query: 109 YNKDTNAFYKLHTDSAKIWDAKSSC 183 Y K + KLH + K+ + ++SC Sbjct: 12 YRKKDRRYEKLHNEKEKLLEERTSC 36 >DQ325092-1|ABD14106.1| 175|Apis mellifera complementary sex determiner protein. Length = 175 Score = 24.2 bits (50), Expect = 0.37 Identities = 8/25 (32%), Positives = 14/25 (56%) Frame = +1 Query: 109 YNKDTNAFYKLHTDSAKIWDAKSSC 183 Y K + KLH + K+ + ++SC Sbjct: 12 YRKKDRRYEKLHNEKEKLLEERTSC 36 >DQ325091-1|ABD14105.1| 175|Apis mellifera complementary sex determiner protein. Length = 175 Score = 24.2 bits (50), Expect = 0.37 Identities = 8/25 (32%), Positives = 14/25 (56%) Frame = +1 Query: 109 YNKDTNAFYKLHTDSAKIWDAKSSC 183 Y K + KLH + K+ + ++SC Sbjct: 12 YRKKDRRYEKLHNEKEKLLEERTSC 36 >AY569716-1|AAS86669.1| 406|Apis mellifera complementary sex determiner protein. Length = 406 Score = 24.2 bits (50), Expect = 0.37 Identities = 8/25 (32%), Positives = 14/25 (56%) Frame = +1 Query: 109 YNKDTNAFYKLHTDSAKIWDAKSSC 183 Y K + KLH + K+ + ++SC Sbjct: 245 YRKKDRRYEKLHNEKEKLLEERTSC 269 >AY569710-1|AAS86663.1| 408|Apis mellifera complementary sex determiner protein. Length = 408 Score = 24.2 bits (50), Expect = 0.37 Identities = 8/25 (32%), Positives = 14/25 (56%) Frame = +1 Query: 109 YNKDTNAFYKLHTDSAKIWDAKSSC 183 Y K + KLH + K+ + ++SC Sbjct: 245 YRKKDRRYEKLHNEKEKLLEERTSC 269 >AY569709-1|AAS86662.1| 408|Apis mellifera complementary sex determiner protein. Length = 408 Score = 24.2 bits (50), Expect = 0.37 Identities = 8/25 (32%), Positives = 14/25 (56%) Frame = +1 Query: 109 YNKDTNAFYKLHTDSAKIWDAKSSC 183 Y K + KLH + K+ + ++SC Sbjct: 245 YRKKDRRYEKLHNEKEKLLEERTSC 269 >AY569708-1|AAS86661.1| 408|Apis mellifera complementary sex determiner protein. Length = 408 Score = 24.2 bits (50), Expect = 0.37 Identities = 8/25 (32%), Positives = 14/25 (56%) Frame = +1 Query: 109 YNKDTNAFYKLHTDSAKIWDAKSSC 183 Y K + KLH + K+ + ++SC Sbjct: 245 YRKKDRRYEKLHNEKEKLLEERTSC 269 >AY569707-1|AAS86660.1| 408|Apis mellifera complementary sex determiner protein. Length = 408 Score = 24.2 bits (50), Expect = 0.37 Identities = 8/25 (32%), Positives = 14/25 (56%) Frame = +1 Query: 109 YNKDTNAFYKLHTDSAKIWDAKSSC 183 Y K + KLH + K+ + ++SC Sbjct: 245 YRKKDRRYEKLHNEKEKLLEERTSC 269 >AY569706-1|AAS86659.1| 397|Apis mellifera complementary sex determiner protein. Length = 397 Score = 24.2 bits (50), Expect = 0.37 Identities = 8/25 (32%), Positives = 14/25 (56%) Frame = +1 Query: 109 YNKDTNAFYKLHTDSAKIWDAKSSC 183 Y K + KLH + K+ + ++SC Sbjct: 234 YRKKDRRYEKLHNEKEKLLEERTSC 258 >DQ325103-1|ABD14117.1| 182|Apis mellifera complementary sex determiner protein. Length = 182 Score = 20.6 bits (41), Expect = 4.5 Identities = 7/24 (29%), Positives = 13/24 (54%) Frame = +1 Query: 109 YNKDTNAFYKLHTDSAKIWDAKSS 180 Y K + KLH + K+ + ++S Sbjct: 12 YRKKDRRYEKLHNEKEKLLEERTS 35 >DQ325083-1|ABD14097.1| 189|Apis mellifera complementary sex determiner protein. Length = 189 Score = 20.6 bits (41), Expect = 4.5 Identities = 7/24 (29%), Positives = 13/24 (54%) Frame = +1 Query: 109 YNKDTNAFYKLHTDSAKIWDAKSS 180 Y K + KLH + K+ + ++S Sbjct: 12 YRKKDRQYEKLHNEKEKLLEERTS 35 >AY569720-1|AAS86673.1| 406|Apis mellifera complementary sex determiner protein. Length = 406 Score = 20.6 bits (41), Expect = 4.5 Identities = 7/24 (29%), Positives = 13/24 (54%) Frame = +1 Query: 109 YNKDTNAFYKLHTDSAKIWDAKSS 180 Y K + KLH + K+ + ++S Sbjct: 245 YRKKDRQYEKLHNEKEKLLEERTS 268 >AY569717-1|AAS86670.1| 397|Apis mellifera complementary sex determiner protein. Length = 397 Score = 20.6 bits (41), Expect = 4.5 Identities = 7/24 (29%), Positives = 13/24 (54%) Frame = +1 Query: 109 YNKDTNAFYKLHTDSAKIWDAKSS 180 Y K + KLH + K+ + ++S Sbjct: 234 YRKKDRQYEKLHNEKEKLLEERTS 257 >AY569712-1|AAS86665.1| 408|Apis mellifera complementary sex determiner protein. Length = 408 Score = 20.6 bits (41), Expect = 4.5 Identities = 7/24 (29%), Positives = 13/24 (54%) Frame = +1 Query: 109 YNKDTNAFYKLHTDSAKIWDAKSS 180 Y K + KLH + K+ + ++S Sbjct: 245 YRKKDRQYEKLHNEKEKLLEERTS 268 >AY569703-1|AAS86656.1| 396|Apis mellifera complementary sex determiner protein. Length = 396 Score = 20.6 bits (41), Expect = 4.5 Identities = 7/24 (29%), Positives = 13/24 (54%) Frame = +1 Query: 109 YNKDTNAFYKLHTDSAKIWDAKSS 180 Y K + KLH + K+ + ++S Sbjct: 234 YRKKDRQYEKLHNEKEKLLEERTS 257 >AY569701-1|AAS86654.1| 407|Apis mellifera complementary sex determiner protein. Length = 407 Score = 20.6 bits (41), Expect = 4.5 Identities = 7/24 (29%), Positives = 13/24 (54%) Frame = +1 Query: 109 YNKDTNAFYKLHTDSAKIWDAKSS 180 Y K + KLH + K+ + ++S Sbjct: 245 YRKKDRQYEKLHNEKEKLLEERTS 268 >AY569700-1|AAS86653.1| 407|Apis mellifera complementary sex determiner protein. Length = 407 Score = 20.6 bits (41), Expect = 4.5 Identities = 7/24 (29%), Positives = 13/24 (54%) Frame = +1 Query: 109 YNKDTNAFYKLHTDSAKIWDAKSS 180 Y K + KLH + K+ + ++S Sbjct: 245 YRKKDRQYEKLHNEKEKLLEERTS 268 >AY569699-1|AAS86652.1| 396|Apis mellifera complementary sex determiner protein. Length = 396 Score = 20.6 bits (41), Expect = 4.5 Identities = 7/24 (29%), Positives = 13/24 (54%) Frame = +1 Query: 109 YNKDTNAFYKLHTDSAKIWDAKSS 180 Y K + KLH + K+ + ++S Sbjct: 234 YRKKDRQYEKLHNEKEKLLEERTS 257 >AY569697-1|AAS86650.1| 413|Apis mellifera complementary sex determiner protein. Length = 413 Score = 20.6 bits (41), Expect = 4.5 Identities = 7/24 (29%), Positives = 13/24 (54%) Frame = +1 Query: 109 YNKDTNAFYKLHTDSAKIWDAKSS 180 Y K + KLH + K+ + ++S Sbjct: 245 YRKKDRRYEKLHNEKEKLLEERTS 268 >AY569694-1|AAS86647.1| 400|Apis mellifera complementary sex determiner protein. Length = 400 Score = 20.6 bits (41), Expect = 4.5 Identities = 7/24 (29%), Positives = 13/24 (54%) Frame = +1 Query: 109 YNKDTNAFYKLHTDSAKIWDAKSS 180 Y K + KLH + K+ + ++S Sbjct: 234 YRKKDRQYEKLHNEKEKLLEERTS 257 >AY352277-1|AAQ67418.1| 418|Apis mellifera complementary sex determiner protein. Length = 418 Score = 20.6 bits (41), Expect = 4.5 Identities = 7/24 (29%), Positives = 13/24 (54%) Frame = +1 Query: 109 YNKDTNAFYKLHTDSAKIWDAKSS 180 Y K + KLH + K+ + ++S Sbjct: 250 YRKKDRRYEKLHNEKEKLLEERTS 273 >AY352276-1|AAQ67417.1| 385|Apis mellifera complementary sex determiner protein. Length = 385 Score = 20.6 bits (41), Expect = 4.5 Identities = 7/24 (29%), Positives = 13/24 (54%) Frame = +1 Query: 109 YNKDTNAFYKLHTDSAKIWDAKSS 180 Y K + KLH + K+ + ++S Sbjct: 245 YKKKDRRYEKLHNEKKKLLEERTS 268 >AY350618-1|AAQ57660.1| 425|Apis mellifera complementary sex determiner protein. Length = 425 Score = 20.6 bits (41), Expect = 4.5 Identities = 7/24 (29%), Positives = 13/24 (54%) Frame = +1 Query: 109 YNKDTNAFYKLHTDSAKIWDAKSS 180 Y K + KLH + K+ + ++S Sbjct: 245 YRKKDRRYEKLHNEKEKLLEERTS 268 >AB161182-1|BAD08344.1| 1040|Apis mellifera metabotropic glutamate receptor protein. Length = 1040 Score = 20.6 bits (41), Expect = 4.5 Identities = 9/21 (42%), Positives = 13/21 (61%) Frame = +1 Query: 67 PPPSVSKQYRSDYVYNKDTNA 129 PP VS+ ++ +KDTNA Sbjct: 984 PPSVVSRSTQTSANNDKDTNA 1004 >AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. Length = 1598 Score = 20.6 bits (41), Expect = 4.5 Identities = 13/48 (27%), Positives = 21/48 (43%), Gaps = 2/48 (4%) Frame = +1 Query: 55 IASAP--PPSVSKQYRSDYVYNKDTNAFYKLHTDSAKIWDAKSSCTTE 192 + SAP P +Q + + N + LH A D KS+C ++ Sbjct: 1443 LTSAPQQPQQQQQQQQQQQQQQQQLNHYPDLHNLYAVPTDKKSACDSK 1490 >L10430-1|AAA27731.1| 150|Apis mellifera transposase protein. Length = 150 Score = 20.2 bits (40), Expect = 6.0 Identities = 8/23 (34%), Positives = 11/23 (47%) Frame = -1 Query: 300 FRIHPPKHSSPDLXIFEHRMKLN 232 F + PP + + EH KLN Sbjct: 81 FELLPPNRTINSVVYIEHLTKLN 103 >Z26318-1|CAA81227.1| 544|Apis mellifera royal jelly protein RJP57-1 protein. Length = 544 Score = 19.8 bits (39), Expect = 7.9 Identities = 8/22 (36%), Positives = 14/22 (63%) Frame = -3 Query: 271 PRSXNL*TSNEAELYPVLKPAP 206 P S N+ T+ + + P+L+P P Sbjct: 93 PSSLNVVTNKKGKGGPLLRPYP 114 >DQ667187-1|ABG75739.1| 428|Apis mellifera histamine-gated chloride channel protein. Length = 428 Score = 19.8 bits (39), Expect = 7.9 Identities = 6/10 (60%), Positives = 7/10 (70%) Frame = -3 Query: 187 WCKSSWRPIS 158 W K+ WRP S Sbjct: 114 WLKNMWRPDS 123 >DQ325133-1|ABD14147.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 19.8 bits (39), Expect = 7.9 Identities = 7/24 (29%), Positives = 12/24 (50%) Frame = +1 Query: 109 YNKDTNAFYKLHTDSAKIWDAKSS 180 Y K + KLH + K + ++S Sbjct: 12 YRKKDRQYEKLHNEKEKFLEERTS 35 >DQ325130-1|ABD14144.1| 174|Apis mellifera complementary sex determiner protein. Length = 174 Score = 19.8 bits (39), Expect = 7.9 Identities = 7/24 (29%), Positives = 12/24 (50%) Frame = +1 Query: 109 YNKDTNAFYKLHTDSAKIWDAKSS 180 Y K + KLH + K + ++S Sbjct: 12 YRKKDRRYEKLHNEKEKFLEERTS 35 >DQ325129-1|ABD14143.1| 174|Apis mellifera complementary sex determiner protein. Length = 174 Score = 19.8 bits (39), Expect = 7.9 Identities = 7/24 (29%), Positives = 12/24 (50%) Frame = +1 Query: 109 YNKDTNAFYKLHTDSAKIWDAKSS 180 Y K + KLH + K + ++S Sbjct: 12 YRKKDRRYEKLHNEKEKFLEERTS 35 >DQ325128-1|ABD14142.1| 174|Apis mellifera complementary sex determiner protein. Length = 174 Score = 19.8 bits (39), Expect = 7.9 Identities = 7/24 (29%), Positives = 12/24 (50%) Frame = +1 Query: 109 YNKDTNAFYKLHTDSAKIWDAKSS 180 Y K + KLH + K + ++S Sbjct: 12 YRKKDRRYEKLHNEKEKFLEERTS 35 >DQ325127-1|ABD14141.1| 174|Apis mellifera complementary sex determiner protein. Length = 174 Score = 19.8 bits (39), Expect = 7.9 Identities = 7/24 (29%), Positives = 12/24 (50%) Frame = +1 Query: 109 YNKDTNAFYKLHTDSAKIWDAKSS 180 Y K + KLH + K + ++S Sbjct: 12 YRKKDRRYEKLHNEKEKFLEERTS 35 >DQ325126-1|ABD14140.1| 174|Apis mellifera complementary sex determiner protein. Length = 174 Score = 19.8 bits (39), Expect = 7.9 Identities = 7/24 (29%), Positives = 12/24 (50%) Frame = +1 Query: 109 YNKDTNAFYKLHTDSAKIWDAKSS 180 Y K + KLH + K + ++S Sbjct: 12 YRKKDRRYEKLHNEKEKFLEERTS 35 >DQ325125-1|ABD14139.1| 174|Apis mellifera complementary sex determiner protein. Length = 174 Score = 19.8 bits (39), Expect = 7.9 Identities = 7/24 (29%), Positives = 12/24 (50%) Frame = +1 Query: 109 YNKDTNAFYKLHTDSAKIWDAKSS 180 Y K + KLH + K + ++S Sbjct: 12 YRKKDRRYEKLHNEKEKFLEERTS 35 >DQ325115-1|ABD14129.1| 185|Apis mellifera complementary sex determiner protein. Length = 185 Score = 19.8 bits (39), Expect = 7.9 Identities = 7/24 (29%), Positives = 12/24 (50%) Frame = +1 Query: 109 YNKDTNAFYKLHTDSAKIWDAKSS 180 Y K + KLH + K + ++S Sbjct: 12 YRKKDRQYEKLHNEKEKFLEERTS 35 >DQ325075-1|ABD14089.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 19.8 bits (39), Expect = 7.9 Identities = 7/24 (29%), Positives = 12/24 (50%) Frame = +1 Query: 109 YNKDTNAFYKLHTDSAKIWDAKSS 180 Y K + KLH + K + ++S Sbjct: 12 YRKKDRQYEKLHNEKEKFLEERTS 35 >DQ325074-1|ABD14088.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 19.8 bits (39), Expect = 7.9 Identities = 7/24 (29%), Positives = 12/24 (50%) Frame = +1 Query: 109 YNKDTNAFYKLHTDSAKIWDAKSS 180 Y K + KLH + K + ++S Sbjct: 12 YRKKDRQYEKLHNEKEKFLEERTS 35 >DQ325073-1|ABD14087.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 19.8 bits (39), Expect = 7.9 Identities = 7/24 (29%), Positives = 12/24 (50%) Frame = +1 Query: 109 YNKDTNAFYKLHTDSAKIWDAKSS 180 Y K + KLH + K + ++S Sbjct: 12 YRKKDRQYEKLHNEKEKFLEERTS 35 >DQ325072-1|ABD14086.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 19.8 bits (39), Expect = 7.9 Identities = 7/24 (29%), Positives = 12/24 (50%) Frame = +1 Query: 109 YNKDTNAFYKLHTDSAKIWDAKSS 180 Y K + KLH + K + ++S Sbjct: 12 YRKKDRQYEKLHNEKEKFLEERTS 35 >DQ325071-1|ABD14085.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 19.8 bits (39), Expect = 7.9 Identities = 7/24 (29%), Positives = 12/24 (50%) Frame = +1 Query: 109 YNKDTNAFYKLHTDSAKIWDAKSS 180 Y K + KLH + K + ++S Sbjct: 12 YRKKDRQYEKLHNEKEKFLEERTS 35 >DQ325070-1|ABD14084.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 19.8 bits (39), Expect = 7.9 Identities = 7/24 (29%), Positives = 12/24 (50%) Frame = +1 Query: 109 YNKDTNAFYKLHTDSAKIWDAKSS 180 Y K + KLH + K + ++S Sbjct: 12 YRKKDRQYEKLHNEKEKFLEERTS 35 >DQ325069-1|ABD14083.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 19.8 bits (39), Expect = 7.9 Identities = 7/24 (29%), Positives = 12/24 (50%) Frame = +1 Query: 109 YNKDTNAFYKLHTDSAKIWDAKSS 180 Y K + KLH + K + ++S Sbjct: 12 YRKKDRQYEKLHNEKEKFLEERTS 35 >DQ325068-1|ABD14082.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 19.8 bits (39), Expect = 7.9 Identities = 7/24 (29%), Positives = 12/24 (50%) Frame = +1 Query: 109 YNKDTNAFYKLHTDSAKIWDAKSS 180 Y K + KLH + K + ++S Sbjct: 12 YRKKDRQYEKLHNEKEKFLEERTS 35 >AY569698-1|AAS86651.1| 407|Apis mellifera complementary sex determiner protein. Length = 407 Score = 19.8 bits (39), Expect = 7.9 Identities = 7/24 (29%), Positives = 12/24 (50%) Frame = +1 Query: 109 YNKDTNAFYKLHTDSAKIWDAKSS 180 Y K + KLH + K + ++S Sbjct: 245 YRKKDRQYEKLHNEKEKFLEERTS 268 >AY569696-1|AAS86649.1| 414|Apis mellifera complementary sex determiner protein. Length = 414 Score = 19.8 bits (39), Expect = 7.9 Identities = 7/24 (29%), Positives = 12/24 (50%) Frame = +1 Query: 109 YNKDTNAFYKLHTDSAKIWDAKSS 180 Y K + KLH + K + ++S Sbjct: 245 YRKKDRQYEKLHNEKEKFLEERTS 268 >AY569695-1|AAS86648.1| 414|Apis mellifera complementary sex determiner protein. Length = 414 Score = 19.8 bits (39), Expect = 7.9 Identities = 7/24 (29%), Positives = 12/24 (50%) Frame = +1 Query: 109 YNKDTNAFYKLHTDSAKIWDAKSS 180 Y K + KLH + K + ++S Sbjct: 245 YRKKDRQYEKLHNEKEKFLEERTS 268 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 82,417 Number of Sequences: 438 Number of extensions: 1532 Number of successful extensions: 49 Number of sequences better than 10.0: 48 Number of HSP's better than 10.0 without gapping: 49 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 49 length of database: 146,343 effective HSP length: 49 effective length of database: 124,881 effective search space used: 6493812 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 38 (20.3 bits)
- SilkBase 1999-2023 -