BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbS20200 (379 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_48509| Best HMM Match : DUF352 (HMM E-Value=2.4) 31 0.41 SB_40989| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 5.1 >SB_48509| Best HMM Match : DUF352 (HMM E-Value=2.4) Length = 268 Score = 30.7 bits (66), Expect = 0.41 Identities = 20/68 (29%), Positives = 30/68 (44%) Frame = +3 Query: 156 SITASPKY*SRMKRNVEPAASTIKYXXXIRDTNSKSKSSXYEGQLEFQFKNKGQSKDLKN 335 +IT Y +R K N E A + +K R S+ ++ + Q K KG+ KN Sbjct: 120 AITGEGGYATRSKSNWEKAITFVKLAVQNRPQQSEEENKTFVTQQVTSKKRKGRKASPKN 179 Query: 336 XFTLRNLP 359 T +LP Sbjct: 180 PETSTSLP 187 >SB_40989| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 146 Score = 27.1 bits (57), Expect = 5.1 Identities = 14/37 (37%), Positives = 23/37 (62%), Gaps = 2/37 (5%) Frame = -3 Query: 128 D*LHKTDTFHLAERFPLW--HELLRLNRNYLPNGYLV 24 D L+KT T++L R PL+ H + + + L NG++V Sbjct: 61 DTLYKTGTWYLISRHPLYNGHVVSHITTHSLYNGHVV 97 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,267,243 Number of Sequences: 59808 Number of extensions: 162883 Number of successful extensions: 301 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 271 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 301 length of database: 16,821,457 effective HSP length: 74 effective length of database: 12,395,665 effective search space used: 632178915 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -