BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbS20200 (379 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AB259784-1|BAF48662.1| 323|Caenorhabditis elegans ROG-1 protein. 28 1.9 Z98866-25|CAL22710.1| 325|Caenorhabditis elegans Hypothetical p... 27 4.5 >AB259784-1|BAF48662.1| 323|Caenorhabditis elegans ROG-1 protein. Length = 323 Score = 28.3 bits (60), Expect = 1.9 Identities = 13/29 (44%), Positives = 17/29 (58%) Frame = -3 Query: 245 AYXXXVFDRRSGRLHVSLHPRSVLWXSRY 159 +Y FD RSGR++ + PRSV S Y Sbjct: 242 SYHRSSFDPRSGRINTPMRPRSVTDTSDY 270 >Z98866-25|CAL22710.1| 325|Caenorhabditis elegans Hypothetical protein Y49E10.28 protein. Length = 325 Score = 27.1 bits (57), Expect = 4.5 Identities = 19/46 (41%), Positives = 27/46 (58%), Gaps = 4/46 (8%) Frame = -3 Query: 128 D*LHKTDTFHL--AERFPLWH--ELLRLNRNYLPNGYLVRSSFRRI 3 D LHKTD ++ A R + LL++ N P+G LVR++FR I Sbjct: 235 DELHKTDHWNRENASRSEICRLDALLKMAANSDPSGELVRTAFRSI 280 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 7,692,999 Number of Sequences: 27780 Number of extensions: 126691 Number of successful extensions: 233 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 232 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 233 length of database: 12,740,198 effective HSP length: 73 effective length of database: 10,712,258 effective search space used: 557037416 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -