BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbS20195 (508 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U21943-1|AAA87732.1| 670|Homo sapiens organic anion transportin... 29 7.1 BC042452-1|AAH42452.2| 408|Homo sapiens SLCO1A2 protein protein. 29 7.1 AJ400735-1|CAB97006.1| 670|Homo sapiens organic anion transport... 29 7.1 AF279784-1|AAG30037.1| 670|Homo sapiens organic anion transport... 29 7.1 AF085224-1|AAD52694.1| 579|Homo sapiens brain organic anion tra... 29 7.1 >U21943-1|AAA87732.1| 670|Homo sapiens organic anion transporting polypeptide protein. Length = 670 Score = 29.5 bits (63), Expect = 7.1 Identities = 16/40 (40%), Positives = 26/40 (65%) Frame = +3 Query: 117 LLFIVIIIREFNTHINISLFIKYIYFLRGYGVSS*SDAWF 236 +LFI++ + +FN +N+ F+ Y + YG+SS SDA F Sbjct: 319 MLFILVSVIQFNAFVNMISFMPK-YLEQQYGISS-SDAIF 356 >BC042452-1|AAH42452.2| 408|Homo sapiens SLCO1A2 protein protein. Length = 408 Score = 29.5 bits (63), Expect = 7.1 Identities = 16/40 (40%), Positives = 26/40 (65%) Frame = +3 Query: 117 LLFIVIIIREFNTHINISLFIKYIYFLRGYGVSS*SDAWF 236 +LFI++ + +FN +N+ F+ Y + YG+SS SDA F Sbjct: 299 MLFILVSVIQFNAFVNMISFMPK-YLEQQYGISS-SDAIF 336 >AJ400735-1|CAB97006.1| 670|Homo sapiens organic anion transporting polypeptide 1 (OATP1) protein. Length = 670 Score = 29.5 bits (63), Expect = 7.1 Identities = 16/40 (40%), Positives = 26/40 (65%) Frame = +3 Query: 117 LLFIVIIIREFNTHINISLFIKYIYFLRGYGVSS*SDAWF 236 +LFI++ + +FN +N+ F+ Y + YG+SS SDA F Sbjct: 319 MLFILVSVIQFNAFVNMISFMPK-YLEQQYGISS-SDAIF 356 >AF279784-1|AAG30037.1| 670|Homo sapiens organic anion transporting polypeptide protein. Length = 670 Score = 29.5 bits (63), Expect = 7.1 Identities = 16/40 (40%), Positives = 26/40 (65%) Frame = +3 Query: 117 LLFIVIIIREFNTHINISLFIKYIYFLRGYGVSS*SDAWF 236 +LFI++ + +FN +N+ F+ Y + YG+SS SDA F Sbjct: 319 MLFILVSVIQFNAFVNMISFMPK-YLEQQYGISS-SDAIF 356 >AF085224-1|AAD52694.1| 579|Homo sapiens brain organic anion transporter subtype OATP1b protein. Length = 579 Score = 29.5 bits (63), Expect = 7.1 Identities = 16/40 (40%), Positives = 26/40 (65%) Frame = +3 Query: 117 LLFIVIIIREFNTHINISLFIKYIYFLRGYGVSS*SDAWF 236 +LFI++ + +FN +N+ F+ Y + YG+SS SDA F Sbjct: 317 MLFILVSVIQFNAFVNMISFMPK-YLEQQYGISS-SDAIF 354 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 69,024,747 Number of Sequences: 237096 Number of extensions: 1365562 Number of successful extensions: 1287 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 1175 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1286 length of database: 76,859,062 effective HSP length: 85 effective length of database: 56,705,902 effective search space used: 4706589866 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -