BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbS20194 (594 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g59210.2 68418.m07421 myosin heavy chain-related contains wea... 33 0.14 At5g59210.1 68418.m07420 myosin heavy chain-related contains wea... 33 0.14 At5g10290.1 68418.m01194 leucine-rich repeat family protein / pr... 30 1.0 At1g69390.1 68414.m07966 chloroplast division protein, putative ... 30 1.3 At4g13310.2 68417.m02080 cytochrome P450 71A20, putative (CYP71A... 28 4.1 At4g13310.1 68417.m02081 cytochrome P450 71A20, putative (CYP71A... 28 4.1 At4g15480.1 68417.m02366 UDP-glucoronosyl/UDP-glucosyl transfera... 28 5.4 At3g43890.1 68416.m04698 DC1 domain-containing protein contains ... 27 7.1 At1g64255.1 68414.m07280 SWIM zinc finger family protein contain... 27 7.1 At2g33860.1 68415.m04157 auxin-responsive factor (ARF3) / ETTIN ... 27 9.4 >At5g59210.2 68418.m07421 myosin heavy chain-related contains weak similarity to Myosin heavy chain, gizzard smooth muscle (Swiss-Prot:P10587) [Gallus gallus] Length = 433 Score = 33.1 bits (72), Expect = 0.14 Identities = 23/69 (33%), Positives = 37/69 (53%), Gaps = 3/69 (4%) Frame = +1 Query: 82 ELSADTSNQDLE-EKLY--NSILTGDYDSAVRQSLEYESQGKGSIIQNVVNNLIIDKRRN 252 +L + NQ E EKL+ NS L+ Y ++ S ++E+Q K + QNV ++DK R Sbjct: 285 KLLMEIDNQSSEIEKLFEENSNLSASYQESINISNQWENQVKECLKQNVELREVLDKLRT 344 Query: 253 TWSTATSCG 279 + + S G Sbjct: 345 EQAGSFSRG 353 >At5g59210.1 68418.m07420 myosin heavy chain-related contains weak similarity to Myosin heavy chain, gizzard smooth muscle (Swiss-Prot:P10587) [Gallus gallus] Length = 434 Score = 33.1 bits (72), Expect = 0.14 Identities = 23/69 (33%), Positives = 37/69 (53%), Gaps = 3/69 (4%) Frame = +1 Query: 82 ELSADTSNQDLE-EKLY--NSILTGDYDSAVRQSLEYESQGKGSIIQNVVNNLIIDKRRN 252 +L + NQ E EKL+ NS L+ Y ++ S ++E+Q K + QNV ++DK R Sbjct: 286 KLLMEIDNQSSEIEKLFEENSNLSASYQESINISNQWENQVKECLKQNVELREVLDKLRT 345 Query: 253 TWSTATSCG 279 + + S G Sbjct: 346 EQAGSFSRG 354 >At5g10290.1 68418.m01194 leucine-rich repeat family protein / protein kinase family protein contains Pfam domains PF00560: Leucine Rich Repeat and PF00069: Protein kinase domain Length = 613 Score = 30.3 bits (65), Expect = 1.0 Identities = 16/61 (26%), Positives = 29/61 (47%) Frame = +1 Query: 121 KLYNSILTGDYDSAVRQSLEYESQGKGSIIQNVVNNLIIDKRRNTWSTATSCGSATDRKL 300 K+Y +L + AV++ ++ES G + Q V + + RN C + T+R L Sbjct: 303 KVYKGVLPDNTKVAVKRLTDFESPGGDAAFQREVEMISVAVHRNLLRLIGFCTTQTERLL 362 Query: 301 L 303 + Sbjct: 363 V 363 >At1g69390.1 68414.m07966 chloroplast division protein, putative (MinE1) identical to chloroplast division protein homolog MinE1 GI:17511220 from [Arabidopsis thaliana] Length = 229 Score = 29.9 bits (64), Expect = 1.3 Identities = 14/34 (41%), Positives = 21/34 (61%) Frame = +1 Query: 55 MLAASAGVVELSADTSNQDLEEKLYNSILTGDYD 156 +LA + G ELS + Q++E LYN+I G +D Sbjct: 70 VLARNTGDYELSPSPAEQEIESFLYNAINMGFFD 103 >At4g13310.2 68417.m02080 cytochrome P450 71A20, putative (CYP71A20) Identical to Cytochrome P450 (SP:Q9T0K2) [Arabidopsis thaliana]; similar to cytochrome P450 71A4, Solanum melongena, PIR2:S36805 Length = 390 Score = 28.3 bits (60), Expect = 4.1 Identities = 15/39 (38%), Positives = 22/39 (56%) Frame = +1 Query: 121 KLYNSILTGDYDSAVRQSLEYESQGKGSIIQNVVNNLII 237 K+ + IL+G D A EY Q K IQN++NN ++ Sbjct: 103 KVVDKILSGGRDVAFAPYGEYWRQMKSICIQNLLNNKMV 141 >At4g13310.1 68417.m02081 cytochrome P450 71A20, putative (CYP71A20) Identical to Cytochrome P450 (SP:Q9T0K2) [Arabidopsis thaliana]; similar to cytochrome P450 71A4, Solanum melongena, PIR2:S36805 Length = 497 Score = 28.3 bits (60), Expect = 4.1 Identities = 15/39 (38%), Positives = 22/39 (56%) Frame = +1 Query: 121 KLYNSILTGDYDSAVRQSLEYESQGKGSIIQNVVNNLII 237 K+ + IL+G D A EY Q K IQN++NN ++ Sbjct: 103 KVVDKILSGGRDVAFAPYGEYWRQMKSICIQNLLNNKMV 141 >At4g15480.1 68417.m02366 UDP-glucoronosyl/UDP-glucosyl transferase family protein contains Pfam profile: PF00201 UDP-glucoronosyl and UDP-glucosyl transferase Length = 490 Score = 27.9 bits (59), Expect = 5.4 Identities = 10/28 (35%), Positives = 15/28 (53%) Frame = -1 Query: 297 FPVRCRPTACSSTPCVPSLVNDQVVNYI 214 FP P PCVP L ND++ +++ Sbjct: 174 FPTETEPELDVKLPCVPVLKNDEIPSFL 201 >At3g43890.1 68416.m04698 DC1 domain-containing protein contains Pfam profile PF03107: DC1 domain Length = 661 Score = 27.5 bits (58), Expect = 7.1 Identities = 17/40 (42%), Positives = 22/40 (55%), Gaps = 5/40 (12%) Frame = +2 Query: 29 NFSLYLRCACSPPAR--ASLN---YPRTLLTKTSRRNCTT 133 NFSL L+C PP + LN +P TL+ K+ CTT Sbjct: 228 NFSLDLQCVFHPPKQNPHDLNIHDHPLTLMPKSISFTCTT 267 >At1g64255.1 68414.m07280 SWIM zinc finger family protein contains Pfam profile PF04434: SWIM zinc finger Length = 750 Score = 27.5 bits (58), Expect = 7.1 Identities = 11/23 (47%), Positives = 14/23 (60%) Frame = +3 Query: 258 EYCYKLWVGNGQEIVRKYFPLNF 326 EY KL + +G + KYFPL F Sbjct: 396 EYQLKLMIASGVDAANKYFPLAF 418 >At2g33860.1 68415.m04157 auxin-responsive factor (ARF3) / ETTIN protein (ETT) identical to ETTIN GB:AF007788 from [Arabidopsis thaliana] Length = 608 Score = 27.1 bits (57), Expect = 9.4 Identities = 22/62 (35%), Positives = 26/62 (41%), Gaps = 3/62 (4%) Frame = -1 Query: 306 F*QFPVRCRPTACSSTPCVPSLVNDQVVNYILDD--GXXXXXLIFQ-ALTDSTVVVAGED 136 F F R P + SS+P L N N L+D G +F LTD T VA Sbjct: 509 FQNFSTRILPPSVSSSPSSVLLTNSNSPNGRLEDHHGGSGRCRLFGFPLTDETTAVASAT 568 Query: 135 AV 130 AV Sbjct: 569 AV 570 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,642,709 Number of Sequences: 28952 Number of extensions: 259290 Number of successful extensions: 745 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 726 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 745 length of database: 12,070,560 effective HSP length: 77 effective length of database: 9,841,256 effective search space used: 1180950720 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -