BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbS20192 (501 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC22F3.04 |mug62||AMP binding enzyme |Schizosaccharomyces pomb... 29 0.52 SPAC1556.06.1 |meu1|SPAC1556.06a, SPAC1556.06|sequence orphan|Sc... 27 1.2 SPAPB1E7.04c |||chitinase |Schizosaccharomyces pombe|chr 1|||Manual 27 1.2 SPAC3F10.07c |mug91||dubious|Schizosaccharomyces pombe|chr 1|||M... 27 1.6 SPBC119.13c |prp31||U4/U6 x U5 tri-snRNP complex subunit Prp31|S... 27 2.1 SPBC1711.07 |||WD repeat protein Rrb1 |Schizosaccharomyces pombe... 25 4.8 SPBC27B12.06 |gpi13||pig-O |Schizosaccharomyces pombe|chr 2|||Ma... 25 6.4 SPBP19A11.04c |mor2|cps12|morphogenesis protein Mor2|Schizosacch... 25 6.4 SPAC1B9.03c ||SPAC6B12.01|RNA-binding protein|Schizosaccharomyce... 25 6.4 SPBP35G2.10 |mit1||SHREC complex subunit Mit1|Schizosaccharomyce... 25 8.4 SPBC21.05c |ral2||Ras guanyl-nucleotide exchange factor Ral2 |Sc... 25 8.4 >SPAC22F3.04 |mug62||AMP binding enzyme |Schizosaccharomyces pombe|chr 1|||Manual Length = 1428 Score = 28.7 bits (61), Expect = 0.52 Identities = 13/25 (52%), Positives = 17/25 (68%) Frame = -3 Query: 352 VHKLNRVFGEDKSELNWETIPDDVL 278 +H + EDKS+L +ETIPD VL Sbjct: 9 IHPVRHSKYEDKSKLPFETIPDPVL 33 >SPAC1556.06.1 |meu1|SPAC1556.06a, SPAC1556.06|sequence orphan|Schizosaccharomyces pombe|chr 1|||Manual Length = 776 Score = 27.5 bits (58), Expect = 1.2 Identities = 12/27 (44%), Positives = 17/27 (62%) Frame = +3 Query: 108 QLYNSVXVADYDSAVEKSKHLYEEKKS 188 QL N DY+ E++K LY+E+KS Sbjct: 184 QLQNENFKDDYEKIKEENKRLYKERKS 210 >SPAPB1E7.04c |||chitinase |Schizosaccharomyces pombe|chr 1|||Manual Length = 1236 Score = 27.5 bits (58), Expect = 1.2 Identities = 17/35 (48%), Positives = 21/35 (60%), Gaps = 1/35 (2%) Frame = +3 Query: 267 SRAPRTSSGIVSQLSSDLSSP-KTRLSLCTSATVS 368 S P T S + S LSS SSP T LS+ +S+T S Sbjct: 567 SSIPSTFSSVSSILSSSTSSPSSTSLSISSSSTSS 601 >SPAC3F10.07c |mug91||dubious|Schizosaccharomyces pombe|chr 1|||Manual Length = 172 Score = 27.1 bits (57), Expect = 1.6 Identities = 11/25 (44%), Positives = 17/25 (68%) Frame = -2 Query: 284 CPWSPGAKVDGVLHAVHLVVSYQFV 210 CPWS G +DG+L + + +S +FV Sbjct: 52 CPWSIGNLLDGILSVLTIYIS-EFV 75 >SPBC119.13c |prp31||U4/U6 x U5 tri-snRNP complex subunit Prp31|Schizosaccharomyces pombe|chr 2|||Manual Length = 518 Score = 26.6 bits (56), Expect = 2.1 Identities = 13/23 (56%), Positives = 16/23 (69%) Frame = +3 Query: 297 VSQLSSDLSSPKTRLSLCTSATV 365 VS L +DL + KT+LS SATV Sbjct: 166 VSSLLNDLDNSKTKLSFLPSATV 188 >SPBC1711.07 |||WD repeat protein Rrb1 |Schizosaccharomyces pombe|chr 2|||Manual Length = 480 Score = 25.4 bits (53), Expect = 4.8 Identities = 10/31 (32%), Positives = 16/31 (51%) Frame = -2 Query: 293 PGRCPWSPGAKVDGVLHAVHLVVSYQFVHDI 201 P + PW PG K++ V Y+ +H+I Sbjct: 70 PSKIPWLPGGKINADEKLVADPSVYEMLHNI 100 >SPBC27B12.06 |gpi13||pig-O |Schizosaccharomyces pombe|chr 2|||Manual Length = 918 Score = 25.0 bits (52), Expect = 6.4 Identities = 13/37 (35%), Positives = 19/37 (51%) Frame = -3 Query: 283 VLGALEPKLMAYSMQFILLFRISLFTTFVMTSLFFSS 173 +L + KLM Y F+ L S+F TF+ F S+ Sbjct: 502 LLNSFNQKLMEYFKGFVKLDYFSIFITFLHVCSFGSN 538 >SPBP19A11.04c |mor2|cps12|morphogenesis protein Mor2|Schizosaccharomyces pombe|chr 2|||Manual Length = 2196 Score = 25.0 bits (52), Expect = 6.4 Identities = 16/37 (43%), Positives = 21/37 (56%) Frame = -3 Query: 367 ETVALVHKLNRVFGEDKSELNWETIPDDVLGALEPKL 257 E V +H L+ F ED+ E E I DV A++PKL Sbjct: 2004 ELVTTLHSLDVFFAEDRDE---ELIQPDV--AVDPKL 2035 >SPAC1B9.03c ||SPAC6B12.01|RNA-binding protein|Schizosaccharomyces pombe|chr 1|||Manual Length = 389 Score = 25.0 bits (52), Expect = 6.4 Identities = 9/24 (37%), Positives = 15/24 (62%) Frame = +2 Query: 353 KRDGLALTLSNDVQGDDGRPAYGD 424 K++G+ + ND G++G AY D Sbjct: 364 KKEGITSSNKNDDSGNEGSSAYSD 387 >SPBP35G2.10 |mit1||SHREC complex subunit Mit1|Schizosaccharomyces pombe|chr 2|||Manual Length = 1418 Score = 24.6 bits (51), Expect = 8.4 Identities = 12/35 (34%), Positives = 19/35 (54%) Frame = +2 Query: 218 DTKQQDELHGVRHQLWLQGSKDIVRDCFPVEFRLI 322 DT++ ELH + +L+ K V D FP + +I Sbjct: 753 DTEKVTELHQILKPFFLRRVKSEVLDNFPTKVEVI 787 >SPBC21.05c |ral2||Ras guanyl-nucleotide exchange factor Ral2 |Schizosaccharomyces pombe|chr 2|||Manual Length = 611 Score = 24.6 bits (51), Expect = 8.4 Identities = 12/32 (37%), Positives = 15/32 (46%) Frame = +3 Query: 78 SDVPNDILEEQLYNSVXVADYDSAVEKSKHLY 173 S +P I E Q + + EKSKHLY Sbjct: 129 SHIPGMITENQTNDDAKEVNGSDVDEKSKHLY 160 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,771,006 Number of Sequences: 5004 Number of extensions: 30725 Number of successful extensions: 127 Number of sequences better than 10.0: 11 Number of HSP's better than 10.0 without gapping: 125 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 127 length of database: 2,362,478 effective HSP length: 68 effective length of database: 2,022,206 effective search space used: 198176188 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -