BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbS20192 (501 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_58974| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.6 SB_28123| Best HMM Match : zf-NF-X1 (HMM E-Value=0.24) 29 2.2 SB_32194| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.8 SB_24046| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.8 SB_41668| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.0 SB_17366| Best HMM Match : Filament (HMM E-Value=0.14) 28 5.0 SB_47995| Best HMM Match : zf-C3HC4 (HMM E-Value=1e-09) 28 5.0 SB_45697| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.0 >SB_58974| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1831 Score = 29.5 bits (63), Expect = 1.6 Identities = 15/61 (24%), Positives = 28/61 (45%) Frame = +3 Query: 108 QLYNSVXVADYDSAVEKSKHLYEEKKSEVITNVVNKLIRNNKMNCMEYAINFGSRAPRTS 287 ++YNS+ Y+S K + K + + N + + N + NC+ + IN + S Sbjct: 325 EIYNSLDNKIYNSLDNKIYNSLNNKINNSLDNKIYNSLDNKRYNCLNFHINTDHHSYHAS 384 Query: 288 S 290 S Sbjct: 385 S 385 Score = 29.5 bits (63), Expect = 1.6 Identities = 15/61 (24%), Positives = 28/61 (45%) Frame = +3 Query: 108 QLYNSVXVADYDSAVEKSKHLYEEKKSEVITNVVNKLIRNNKMNCMEYAINFGSRAPRTS 287 ++YNS+ Y+S K + K + + N + + N + NC+ + IN + S Sbjct: 418 EIYNSLDNKIYNSLDNKIYNSLNNKINNSLDNKIYNSLDNKRYNCLNFHINTDHHSYHAS 477 Query: 288 S 290 S Sbjct: 478 S 478 >SB_28123| Best HMM Match : zf-NF-X1 (HMM E-Value=0.24) Length = 453 Score = 29.1 bits (62), Expect = 2.2 Identities = 14/46 (30%), Positives = 26/46 (56%) Frame = +3 Query: 180 KKSEVITNVVNKLIRNNKMNCMEYAINFGSRAPRTSSGIVSQLSSD 317 K+ ++TN+ + I N++N + INF R S + +++SSD Sbjct: 214 KEKMILTNLKSPRITANQLNVYKNQINFLKRMFELQSALEAEVSSD 259 >SB_32194| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 316 Score = 28.7 bits (61), Expect = 2.8 Identities = 19/71 (26%), Positives = 34/71 (47%) Frame = +3 Query: 159 SKHLYEEKKSEVITNVVNKLIRNNKMNCMEYAINFGSRAPRTSSGIVSQLSSDLSSPKTR 338 S+ L +EKK E ++ + + N K + + + NF + P S +L ++ +S + Sbjct: 224 SQRLEKEKKKEWVSCIKKTEVTNRKRSLVSFLRNFATGNPFFPSFFHYELPAEEASGTST 283 Query: 339 LSLCTSATVSL 371 L T VSL Sbjct: 284 GRLITRCQVSL 294 >SB_24046| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2848 Score = 28.3 bits (60), Expect = 3.8 Identities = 22/86 (25%), Positives = 40/86 (46%), Gaps = 5/86 (5%) Frame = +3 Query: 114 YNSVXVADYDSAVEKSKHLYEEKKSEVITNVVNKL--IRNNKMNCMEYAINFGSRAPRTS 287 ++SV +DS+V + L+E KK +++ L + + N + SR P S Sbjct: 910 FHSVGGTSWDSSVADEEDLFEVKKKPDKPSLLAALKPVARQESNASLKSNKSASRIPVRS 969 Query: 288 SGIVSQLSSDLSS---PKTRLSLCTS 356 + S +S D S P +R+ + +S Sbjct: 970 DSVKSSVSVDFKSKEPPASRIPVLSS 995 >SB_41668| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 588 Score = 27.9 bits (59), Expect = 5.0 Identities = 18/44 (40%), Positives = 24/44 (54%) Frame = +1 Query: 73 QIPTSLTTFWRSSFTIASXSPITTVRLKRASIYTRRRRAKSSQM 204 +IPTS R SFTI P + VR R S +T RR +S++ Sbjct: 403 RIPTSRVRQTRLSFTIVRRIPTSRVRQTRLS-FTMIRRIPASRV 445 >SB_17366| Best HMM Match : Filament (HMM E-Value=0.14) Length = 306 Score = 27.9 bits (59), Expect = 5.0 Identities = 22/77 (28%), Positives = 37/77 (48%), Gaps = 3/77 (3%) Frame = +3 Query: 150 VEKSKHL---YEEKKSEVITNVVNKLIRNNKMNCMEYAINFGSRAPRTSSGIVSQLSSDL 320 VEK+ L +E +K E+ ++++ E++ F + + T SG++ QL DL Sbjct: 57 VEKNAELRQHFEIEKEELNRKLIHEKEELRYSLEAEFSQKFVNESA-TQSGVIQQLDGDL 115 Query: 321 SSPKTRLSLCTSATVSL 371 KTR SA + L Sbjct: 116 RMMKTRCGELESAMLEL 132 >SB_47995| Best HMM Match : zf-C3HC4 (HMM E-Value=1e-09) Length = 745 Score = 27.9 bits (59), Expect = 5.0 Identities = 29/110 (26%), Positives = 42/110 (38%), Gaps = 1/110 (0%) Frame = +2 Query: 164 AFIRGEEERSHHKCREQTDTKQQDELHGVRHQLWLQGSKDIVRDCFPVEFRLIFAENAIK 343 A R E + CR+ D + V QL K + + C V RL+ E Sbjct: 192 ASARSSLEFAERMCRDANDVDVLSIRNEVLSQLSSLAEKPVDQACTEVGVRLVVDEKYWD 251 Query: 344 LMYKRDGLALTLSNDVQGDDGRPAYGDGKDKTSPR-VSWKVNRSVGEQQG 490 + K++ + LSN G + G ++ R V V RSVG G Sbjct: 252 TLSKKNSVG-DLSNRSVGRSVGRSVGRSVGRSVGRSVGRSVGRSVGRSVG 300 >SB_45697| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 734 Score = 27.9 bits (59), Expect = 5.0 Identities = 20/80 (25%), Positives = 31/80 (38%) Frame = +3 Query: 78 SDVPNDILEEQLYNSVXVADYDSAVEKSKHLYEEKKSEVITNVVNKLIRNNKMNCMEYAI 257 SDVP + Y + + D DSA + S KS + N V + C + Sbjct: 42 SDVPEPVAASTPYQTRELRDMDSANDGSSLKKHTDKSNMAHNAVERFSTETTSVCRSVSE 101 Query: 258 NFGSRAPRTSSGIVSQLSSD 317 S+ P +S + + SD Sbjct: 102 ESQSQEPISSVLVHDESFSD 121 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,573,718 Number of Sequences: 59808 Number of extensions: 237844 Number of successful extensions: 830 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 792 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 830 length of database: 16,821,457 effective HSP length: 77 effective length of database: 12,216,241 effective search space used: 1087245449 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -