BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbS20189 (474 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF229062-1|AAK00751.1| 1443|Homo sapiens NAC-delta splice varian... 30 3.6 AF229061-1|AAK00750.1| 1399|Homo sapiens NAC-gamma splice varian... 30 3.6 >AF229062-1|AAK00751.1| 1443|Homo sapiens NAC-delta splice variant protein. Length = 1443 Score = 30.3 bits (65), Expect = 3.6 Identities = 18/52 (34%), Positives = 26/52 (50%) Frame = +1 Query: 154 LRQRCPSELGIREPRQGLHHPECKLTT*SLTEVGTPWSTATSCGSATDSTLS 309 L+Q ++G+R +GL HP CKL V TP + G ++ST S Sbjct: 929 LQQNNLDDVGVRLLCEGLRHPACKLIRLGKPSVMTP-TEGLDTGEMSNSTSS 979 >AF229061-1|AAK00750.1| 1399|Homo sapiens NAC-gamma splice variant protein. Length = 1399 Score = 30.3 bits (65), Expect = 3.6 Identities = 18/52 (34%), Positives = 26/52 (50%) Frame = +1 Query: 154 LRQRCPSELGIREPRQGLHHPECKLTT*SLTEVGTPWSTATSCGSATDSTLS 309 L+Q ++G+R +GL HP CKL V TP + G ++ST S Sbjct: 929 LQQNNLDDVGVRLLCEGLRHPACKLIRLGKPSVMTP-TEGLDTGEMSNSTSS 979 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 62,461,975 Number of Sequences: 237096 Number of extensions: 1210751 Number of successful extensions: 2672 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2468 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2672 length of database: 76,859,062 effective HSP length: 84 effective length of database: 56,942,998 effective search space used: 4156838854 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -