Bombyx BLAST Result against fruitfly

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fbS20187
         (487 letters)

Database: fruitfly 
           53,049 sequences; 24,988,368 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AE013599-1865|AAF58265.1|  953|Drosophila melanogaster CG8561-PA...    29   2.6  

>AE013599-1865|AAF58265.1|  953|Drosophila melanogaster CG8561-PA
           protein.
          Length = 953

 Score = 29.5 bits (63), Expect = 2.6
 Identities = 19/64 (29%), Positives = 28/64 (43%), Gaps = 1/64 (1%)
 Frame = -1

Query: 328 INKKCFLLLYDSHVIAFIYENTPKQLKGQVSGV-ALTSLEKKKSMTRKLKIKTFFFTCKL 152
           I K CF  LY+ H I   + N      G    + +L S++   +  R++K  TF     L
Sbjct: 351 IPKNCFPKLYELHTIDVSHNNISSIFNGVFQTLFSLRSIDLSHNSMREIKSSTFGTLPTL 410

Query: 151 LNFD 140
           L  D
Sbjct: 411 LEMD 414


  Database: fruitfly
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 24,988,368
  Number of sequences in database:  53,049
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 19,724,664
Number of Sequences: 53049
Number of extensions: 340340
Number of successful extensions: 717
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 713
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 717
length of database: 24,988,368
effective HSP length: 79
effective length of database: 20,797,497
effective search space used: 1705394754
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)