BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbS20186 (535 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_56664| Best HMM Match : bZIP_1 (HMM E-Value=0.00033) 31 0.45 SB_37182| Best HMM Match : DUF225 (HMM E-Value=1) 31 0.59 >SB_56664| Best HMM Match : bZIP_1 (HMM E-Value=0.00033) Length = 652 Score = 31.5 bits (68), Expect = 0.45 Identities = 25/77 (32%), Positives = 37/77 (48%), Gaps = 2/77 (2%) Frame = +1 Query: 22 DNKFDSRRKTRAPALGSPPMSAALYVPPGRR*NEVPLSLQL-E*RDSFQLTKARKET-LD 195 +N F S ++ A A G+ P+S L PP + N +++ L E SF+L E+ Sbjct: 62 NNYFFSSKEANAAANGNDPLSQYLNWPPNTQFNTSAIAMILGEPGPSFRLPYGDSESGYS 121 Query: 196 SSAVLKPLHDDNQRSTS 246 S L PL + RS S Sbjct: 122 SDEALSPLSAASYRSAS 138 >SB_37182| Best HMM Match : DUF225 (HMM E-Value=1) Length = 1282 Score = 31.1 bits (67), Expect = 0.59 Identities = 10/20 (50%), Positives = 13/20 (65%) Frame = +2 Query: 80 CLPHSMCHLDAVRMKCHYRC 139 C+P M H+D +KC YRC Sbjct: 1136 CVPQCMLHVDVFPIKCSYRC 1155 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,758,577 Number of Sequences: 59808 Number of extensions: 331898 Number of successful extensions: 981 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 895 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 981 length of database: 16,821,457 effective HSP length: 78 effective length of database: 12,156,433 effective search space used: 1203486867 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -