BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbS20186 (535 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value DQ383819-1|ABD38144.1| 377|Anopheles gambiae abdominal-B protein. 26 0.69 AB090815-2|BAC57906.1| 973|Anopheles gambiae reverse transcript... 23 8.5 >DQ383819-1|ABD38144.1| 377|Anopheles gambiae abdominal-B protein. Length = 377 Score = 26.2 bits (55), Expect = 0.69 Identities = 22/65 (33%), Positives = 28/65 (43%) Frame = -3 Query: 449 EVNFFLYPVGGKYSPDTYQPVPS*CPSRALYISQVFLVIYFYSYNSLKTKFKSIQNYRGQ 270 E NF +P KY PD Y S SR + Q L + SYNS + S + Y Sbjct: 184 EANFQPHPYYPKYEPDAY-ITASTERSRGVTGDQPSLQSSYESYNSSGLRSYSSETYPNP 242 Query: 269 CYSLN 255 SL+ Sbjct: 243 GSSLS 247 >AB090815-2|BAC57906.1| 973|Anopheles gambiae reverse transcriptase protein. Length = 973 Score = 22.6 bits (46), Expect = 8.5 Identities = 8/25 (32%), Positives = 16/25 (64%) Frame = -3 Query: 200 EESNVSLRAFVS*KLSLYSNCSDSG 126 E +++A++ LS++ NC D+G Sbjct: 419 EAIKAAIKAYLEAFLSVFQNCFDTG 443 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 565,478 Number of Sequences: 2352 Number of extensions: 11660 Number of successful extensions: 38 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 38 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 38 length of database: 563,979 effective HSP length: 60 effective length of database: 422,859 effective search space used: 49474503 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -