BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbS20185 (480 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 09_04_0600 + 18883094-18883393,18883606-18883755,18883851-188841... 29 2.6 03_02_0514 + 9038606-9039790,9040211-9040432,9040548-9040655,904... 28 3.4 >09_04_0600 + 18883094-18883393,18883606-18883755,18883851-18884142, 18884697-18884858,18884958-18885021,18887573-18888080 Length = 491 Score = 28.7 bits (61), Expect = 2.6 Identities = 13/39 (33%), Positives = 21/39 (53%) Frame = +2 Query: 305 SLMVSKLKYLVNSHVSSNLLNYRDSTTFSIEIISPKYSC 421 S M L+ V H S +L Y D+TT+ + + +P +C Sbjct: 450 SRMRLALQLCVRRHTSWCMLLYSDTTTYGLNVTAPSGAC 488 >03_02_0514 + 9038606-9039790,9040211-9040432,9040548-9040655, 9041608-9041802,9041905-9042153,9042525-9042672, 9042673-9042779,9043311-9043475,9044506-9045948 Length = 1273 Score = 28.3 bits (60), Expect = 3.4 Identities = 12/26 (46%), Positives = 17/26 (65%) Frame = +2 Query: 332 LVNSHVSSNLLNYRDSTTFSIEIISP 409 +V S SSNLLN +D +F +E + P Sbjct: 492 IVGSVTSSNLLNPQDDLSFKLEYVHP 517 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 8,746,142 Number of Sequences: 37544 Number of extensions: 130381 Number of successful extensions: 249 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 247 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 249 length of database: 14,793,348 effective HSP length: 76 effective length of database: 11,940,004 effective search space used: 991020332 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -