BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbS20185 (480 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_36821| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.37 SB_43314| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.0 SB_2479| Best HMM Match : SecA_PP_bind (HMM E-Value=0.94) 27 6.1 >SB_36821| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1503 Score = 31.5 bits (68), Expect = 0.37 Identities = 18/48 (37%), Positives = 26/48 (54%), Gaps = 4/48 (8%) Frame = -3 Query: 133 AWPSTTSTFTLALDSRF-FLGTFWSAXTSF---SYWCLFIIRRLSRIF 2 AWP T T AL + + +LG + T+F S WCLFI+ + R + Sbjct: 707 AWPEPTPLITSALRADWTWLGRRYGLATTFLIISLWCLFILAKDRRTY 754 >SB_43314| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 326 Score = 29.1 bits (62), Expect = 2.0 Identities = 16/51 (31%), Positives = 25/51 (49%) Frame = +2 Query: 296 FCFSLMVSKLKYLVNSHVSSNLLNYRDSTTFSIEIISPKYSCKKGLF*EMI 448 FC+ M S +NS + + LN++ ST E++ K S G F + I Sbjct: 183 FCWQPMCS-----INSEIRTTFLNFKPSTIADFELLREKLSLLNGTFHQYI 228 >SB_2479| Best HMM Match : SecA_PP_bind (HMM E-Value=0.94) Length = 327 Score = 27.5 bits (58), Expect = 6.1 Identities = 12/33 (36%), Positives = 18/33 (54%) Frame = +2 Query: 269 FSMCTVKINFCFSLMVSKLKYLVNSHVSSNLLN 367 +S+C + F SL LK L+ SS+L+N Sbjct: 243 YSLCPSETEFTISLFTMLLKALIREGASSHLIN 275 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,684,936 Number of Sequences: 59808 Number of extensions: 165469 Number of successful extensions: 317 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 309 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 317 length of database: 16,821,457 effective HSP length: 77 effective length of database: 12,216,241 effective search space used: 1001731762 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -