BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbS20185 (480 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g07680.1 68415.m00992 ABC transporter family protein 29 1.6 At2g20290.1 68415.m02370 myosin, putative similar to myosin (GI:... 27 8.7 >At2g07680.1 68415.m00992 ABC transporter family protein Length = 1194 Score = 29.1 bits (62), Expect = 1.6 Identities = 14/40 (35%), Positives = 20/40 (50%), Gaps = 1/40 (2%) Frame = -3 Query: 145 WCIFAWPSTTSTFTLALDSRF-FLGTFWSAXTSFSYWCLF 29 WC+F W +T + F+L F +G A T F+ LF Sbjct: 256 WCVFFWATTPTLFSLCTFGLFALMGHQLDAATVFTCLALF 295 >At2g20290.1 68415.m02370 myosin, putative similar to myosin (GI:499047) [Arabidopsis thaliana] Length = 1493 Score = 26.6 bits (56), Expect = 8.7 Identities = 12/28 (42%), Positives = 15/28 (53%) Frame = -1 Query: 327 FNFETINEKQKFIFTVHILNYHREHYTK 244 F NEK + FT H+L +E YTK Sbjct: 458 FCINLTNEKLQQHFTQHVLKMEQEEYTK 485 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 7,504,109 Number of Sequences: 28952 Number of extensions: 117365 Number of successful extensions: 270 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 266 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 270 length of database: 12,070,560 effective HSP length: 76 effective length of database: 9,870,208 effective search space used: 819227264 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -