BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbS20181X (511 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 08_02_1216 - 25344638-25345159,25346011-25346511 28 5.0 02_01_0041 + 279583-281622,281724-282047,282315-282443,282526-28... 27 8.8 >08_02_1216 - 25344638-25345159,25346011-25346511 Length = 340 Score = 27.9 bits (59), Expect = 5.0 Identities = 17/58 (29%), Positives = 27/58 (46%) Frame = +2 Query: 296 HDTKPLIISVPNSNYPKNNDLPIPENSELYEDAVAQTSNQQFEDAGFNSHNHASSINS 469 HD P+ P S P ++DLP + L + + A + N + GF N ++ NS Sbjct: 209 HDLPPVPFPNP-SLVPFHHDLPTSFHPPLLQHSHANSKNSSSNNGGFVFPNEPNTTNS 265 >02_01_0041 + 279583-281622,281724-282047,282315-282443,282526-282648, 282768-282923,283224-283349,283426-283560,283815-283942, 284037-284148,284233-284547,284655-284771,284871-285166, 285252-285783,287980-288082,288808-288881,288965-289062, 289340-289380,289977-290032,290170-290244,290377-290469, 290602-290850,290930-291002,291681-291766,291853-291938, 292067-292142,292280-292347,292430-292496,292570-292665, 292741-292843,293214-293309,293396-293466 Length = 2047 Score = 27.1 bits (57), Expect = 8.8 Identities = 20/84 (23%), Positives = 40/84 (47%), Gaps = 2/84 (2%) Frame = +2 Query: 254 NFQSAYSYHKQWEKHDTKPLIISVPNSNYPKNNDLPIPEN-SELYEDAVAQTSNQQF-ED 427 +F + YSY QW+ + S NS P++ +P++ L + A++++ N Sbjct: 345 SFSNNYSYQSQWQTN-------SFSNSMQPESATASLPDSFQSLGQHAISESFNSSTNSQ 397 Query: 428 AGFNSHNHASSINSDYSGQSKSSR 499 FN+ A+S + + S S++ Sbjct: 398 VSFNTAETATSHYGNVNLDSSSTQ 421 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,958,576 Number of Sequences: 37544 Number of extensions: 189116 Number of successful extensions: 571 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 564 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 571 length of database: 14,793,348 effective HSP length: 77 effective length of database: 11,902,460 effective search space used: 1095026320 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -