BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbS20181X (511 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AF388659-1|AAK71995.1| 782|Apis mellifera 1D-myo-inositol-trisp... 25 0.34 AY937243-1|AAX33677.1| 1370|Apis mellifera Toll-like receptor pr... 23 1.4 DQ288391-1|ABC41341.1| 630|Apis mellifera vasa protein protein. 22 4.2 AY395072-1|AAQ96728.1| 593|Apis mellifera GABA neurotransmitter... 21 7.4 AY395071-1|AAQ96727.1| 646|Apis mellifera GABA neurotransmitter... 21 7.4 EF625899-1|ABR45906.1| 1010|Apis mellifera high Glx storage prot... 21 9.8 >AF388659-1|AAK71995.1| 782|Apis mellifera 1D-myo-inositol-trisphosphate 3-kinaseisoform A protein. Length = 782 Score = 25.4 bits (53), Expect = 0.34 Identities = 8/12 (66%), Positives = 9/12 (75%) Frame = -2 Query: 189 CIGRRHSDHCCI 154 C RRHSD CC+ Sbjct: 346 CRSRRHSDSCCL 357 >AY937243-1|AAX33677.1| 1370|Apis mellifera Toll-like receptor protein. Length = 1370 Score = 23.4 bits (48), Expect = 1.4 Identities = 15/44 (34%), Positives = 24/44 (54%) Frame = -2 Query: 138 AHCFWNKFLRLQLDLRNHIVDNLVSHLKLVGHLYVVTKMEMHDD 7 A F + F LDLRN+ +D + S+ L LY + +E+ D+ Sbjct: 352 ARMFKDLFFLQILDLRNNSIDRIESNAFL--PLYNLHTLELSDN 393 >DQ288391-1|ABC41341.1| 630|Apis mellifera vasa protein protein. Length = 630 Score = 21.8 bits (44), Expect = 4.2 Identities = 8/26 (30%), Positives = 14/26 (53%) Frame = +2 Query: 431 GFNSHNHASSINSDYSGQSKSSRNSR 508 GFN+ N N+DY ++++R Sbjct: 102 GFNNKNKDGDDNNDYEDNDYGNQDNR 127 >AY395072-1|AAQ96728.1| 593|Apis mellifera GABA neurotransmitter transporter-1B protein. Length = 593 Score = 21.0 bits (42), Expect = 7.4 Identities = 6/14 (42%), Positives = 10/14 (71%) Frame = -1 Query: 310 WFCVMFFPLLMIAV 269 W C+ FF L++I + Sbjct: 376 WSCLFFFMLILIGL 389 >AY395071-1|AAQ96727.1| 646|Apis mellifera GABA neurotransmitter transporter-1B protein. Length = 646 Score = 21.0 bits (42), Expect = 7.4 Identities = 6/14 (42%), Positives = 10/14 (71%) Frame = -1 Query: 310 WFCVMFFPLLMIAV 269 W C+ FF L++I + Sbjct: 429 WSCLFFFMLILIGL 442 >EF625899-1|ABR45906.1| 1010|Apis mellifera high Glx storage protein protein. Length = 1010 Score = 20.6 bits (41), Expect = 9.8 Identities = 10/42 (23%), Positives = 21/42 (50%) Frame = +3 Query: 231 DTSVHKPKISNQHTAIISNGKNMTQNH*SYQYLIVIIPKIMI 356 + +VH P + +++ + Q+ YQY +I+P + I Sbjct: 426 EVAVHDPVFYQLYKKVMNLYQQYQQSLPVYQYNDLILPGVTI 467 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 116,868 Number of Sequences: 438 Number of extensions: 2388 Number of successful extensions: 6 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 146,343 effective HSP length: 54 effective length of database: 122,691 effective search space used: 14109465 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -