BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbS20180 (477 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC577.13 |syj2||inositol-polyphosphate 5-phosphatase |Schizosa... 27 1.1 SPAC20H4.03c |tfs1||transcription elongation factor TFIIS |Schiz... 25 5.9 SPAPB1A10.06c |||ATP-dependent RNA helicase Dhr1 |Schizosaccharo... 25 5.9 SPBC215.13 |||sequence orphan|Schizosaccharomyces pombe|chr 2|||... 25 7.9 SPAC29B12.07 |sec16||multidomain vesicle coat component Sec16|Sc... 25 7.9 SPAC13C5.07 |rad32|mre11|Rad32 nuclease|Schizosaccharomyces pomb... 25 7.9 SPBC1271.05c |||zinc finger protein zf-AN1 type|Schizosaccharomy... 25 7.9 >SPBC577.13 |syj2||inositol-polyphosphate 5-phosphatase |Schizosaccharomyces pombe|chr 2|||Manual Length = 889 Score = 27.5 bits (58), Expect = 1.1 Identities = 17/42 (40%), Positives = 26/42 (61%) Frame = +3 Query: 174 TNLQSADYDAVILILYPEELNVPLPRHSGASSTESGNLTSTS 299 + L++ + ++ L+ EEL P+PR+S SST S TSTS Sbjct: 99 SKLENVSFISLDQELWDEELFEPMPRNSSPSSTFS---TSTS 137 >SPAC20H4.03c |tfs1||transcription elongation factor TFIIS |Schizosaccharomyces pombe|chr 1|||Manual Length = 293 Score = 25.0 bits (52), Expect = 5.9 Identities = 13/35 (37%), Positives = 21/35 (60%) Frame = -2 Query: 107 VVNARFGDIELQANTRRDGSCGAETRNRKPRSVYL 3 ++ A+ +I+ Q R G G+E RNR RS+Y+ Sbjct: 155 LIIAKAKEIDAQVLARAAGKTGSEYRNRM-RSLYM 188 >SPAPB1A10.06c |||ATP-dependent RNA helicase Dhr1 |Schizosaccharomyces pombe|chr 1|||Manual Length = 1183 Score = 25.0 bits (52), Expect = 5.9 Identities = 10/32 (31%), Positives = 18/32 (56%) Frame = +2 Query: 341 GRIILAPTGKITPYHDARVVKEAAYKGMTRAL 436 GR+ ++P +I+P H AR+ K ++ L Sbjct: 1100 GRVYMSPLTEISPEHLARLAKNTTLLSYSKPL 1131 >SPBC215.13 |||sequence orphan|Schizosaccharomyces pombe|chr 2|||Manual Length = 534 Score = 24.6 bits (51), Expect = 7.9 Identities = 11/27 (40%), Positives = 19/27 (70%) Frame = +3 Query: 255 SGASSTESGNLTSTSTSRRRCGNATTY 335 S +SST S LTS+S+S R +++++ Sbjct: 373 SSSSSTSSSTLTSSSSSSSRPASSSSH 399 >SPAC29B12.07 |sec16||multidomain vesicle coat component Sec16|Schizosaccharomyces pombe|chr 1|||Manual Length = 1995 Score = 24.6 bits (51), Expect = 7.9 Identities = 11/33 (33%), Positives = 16/33 (48%) Frame = +2 Query: 236 RAIAETFGSFVDGIGKLDKHIHKSATVWQCDYV 334 R + E G ++ GK+DKH A W Y+ Sbjct: 1142 RHLKEFKGPYLASNGKVDKHGKAEAIEWLSKYI 1174 >SPAC13C5.07 |rad32|mre11|Rad32 nuclease|Schizosaccharomyces pombe|chr 1|||Manual Length = 649 Score = 24.6 bits (51), Expect = 7.9 Identities = 13/43 (30%), Positives = 24/43 (55%), Gaps = 3/43 (6%) Frame = +3 Query: 90 EAGVHNVINDRPKMPFVEYKLYENI---FIETNLQSADYDAVI 209 E + ++IND PK+ + K YE + ET++ A++ V+ Sbjct: 502 EQEISSIINDLPKISTTKRKDYEELPEEVSETSINIAEHTPVL 544 >SPBC1271.05c |||zinc finger protein zf-AN1 type|Schizosaccharomyces pombe|chr 2|||Manual Length = 215 Score = 24.6 bits (51), Expect = 7.9 Identities = 12/32 (37%), Positives = 17/32 (53%) Frame = +3 Query: 234 NVPLPRHSGASSTESGNLTSTSTSRRRCGNAT 329 N+ P S++ LT +TSRRRC + T Sbjct: 123 NLTNPPLESEKSSDKALLTRPATSRRRCCHPT 154 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,950,922 Number of Sequences: 5004 Number of extensions: 39002 Number of successful extensions: 105 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 104 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 105 length of database: 2,362,478 effective HSP length: 67 effective length of database: 2,027,210 effective search space used: 184476110 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -